SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017516 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017516
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.55e-27
Family Nucleotide and nucleoside kinases 0.000000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017516   Gene: ENSONIG00000013935   Transcript: ENSONIT00000017531
Sequence length 174
Comment pep:known_by_projection scaffold:Orenil1.0:GL831364.1:359285:364422:-1 gene:ENSONIG00000013935 transcript:ENSONIT00000017531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTKKQPNILLTGTPGVGKTTLGKELAQRTGLTYVNIGDLAQEGQLFDGYDEEYQCPILD
EDRVVDELDEKMSEGGVIVDYHGCDLFPERWFDIVFVLRTDNTQLYTRLEARGYTGKKLQ
DNVQCEIFQTIYEEAMEAYSKEIVHQLPSNTPEDMEHNLDQIVQWTEQWMKDHN
Download sequence
Identical sequences I3K8S1
ENSONIP00000017516 XP_003457078.1.78416 XP_005461888.1.78416 ENSONIP00000017516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]