SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017523 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017523
Domain Number 1 Region: 20-769
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-256
Family Motor proteins 0.0000000000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017523   Gene: ENSONIG00000013941   Transcript: ENSONIT00000017538
Sequence length 1046
Comment pep:known_by_projection scaffold:Orenil1.0:GL831275.1:1032392:1043317:1 gene:ENSONIG00000013941 transcript:ENSONIT00000017538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEERCNRILRNMEASLTARDRVGIQDFVLLDTYTSETAFLDNLRKRFHENLIYTYIGTLL
VSVNPYKELDIYSKKQMDTYMGVNFFELPPHIYALADNAFRTMMSEFNNHFILISGESGA
GKTEASKKILQFYAVSCPSTKVLNNVRDRLLLSNPVLEAFGNAKTLKNDNSSRFGKYMDI
QFDHQGGAVGGHILSYLLEKSRVVHQNHGERNFHIFYQLVEGGEEDLLRWLGLERNCKHY
RYLVQGKCAKVSSINDKSDWKTVRKALSVIDLSESDIENLFGIIASVLHMGNIKFEADAR
GYATLNNNQEMQWVSKLLGIPNQVLQQGLTHRKIEAKSEEVFSPFSVDHAVYARDALAKA
IYGRTFSWLVNKINESLANMNCLSTACLMKTVIGLLDIYGFEVFSVNSFEQFCINYCNEK
LQQLFIELTLKSEQEEYEMEGIEWEPVPYFNNKIICDLVEEKFRGIISLLDEECLRPGEA
TDLTFLEKMEDKIGGHPHFVTHKLADQKTRKTLERGDFRLLHYAGEVTYCVVGFLDKNND
LLYRNGKEVMRQSKNAIIKHCFPSTEPDSKRRPETVVTQFKNSLVGLTEILMMKEPWYVR
CIKPNEAKQPGHFDDVLVRHQVKYLGLMEHLRVRRAGFAYRRKYEIFLQRYKPLCPDTWP
NWKGTAAEGVRCLIKHLGYKSDEYKMGSARTKIFIRHPRTLFATEDAFQVCKHKLATRIQ
AKYKGYKHPLNLKQTMPCLIKIATKIETCWRGLMARRERQRRAWAVKVIKKFIKGFMNRH
QPACTDNSEYLAYVRHSYLTRLKENLPKTVLEKDSWLTPPPILQEVSQVLKKIYIRHMVR
KYVLGITPQRKAQLLLKAQTSALFKGKKENYPFSVCRPFADTRICAEDISIKVLQMIQHE
KVKYSVPVVKYDRNGFRPRLRQLIFTQEAAYLVEEAKIKQWIDYSSLKGVSVSNLSDNFL
ILHVTCDDSKQKGDLVLQCDFLFEALTKLSVIANKQNCIHVVQGSVRFDIQPGREGFVDF
KSGQESMVYRAKNGHLMVESTKTKSR
Download sequence
Identical sequences I3K8S8
ENSONIP00000017523 ENSONIP00000017523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]