SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017608 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017608
Domain Number 1 Region: 539-814
Classification Level Classification E-value
Superfamily RNI-like 7.63e-54
Family 28-residue LRR 0.0000949
Further Details:      
 
Domain Number 2 Region: 806-986
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-49
Family SPRY domain 0.00078
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000017608
Domain Number - Region: 102-270
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0531
Family G proteins 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017608   Gene: ENSONIG00000014008   Transcript: ENSONIT00000017623
Sequence length 990
Comment pep:novel scaffold:Orenil1.0:GL831566.1:64677:165314:1 gene:ENSONIG00000014008 transcript:ENSONIT00000017623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKWEQMADYLQKKYTSLLCQQRLKSTLKKKFQCVYEGVAKAGNPTLLNQIYTELYITEGG
TAEVNDEHEVRQIETASRKPDKPETTIRQEDIFKASPGRDEPIRTLLTKGVAGIGKTVLT
QKYTLDWAEDKANQDIQFIFPFTFRELNVLKRRRFSLVELVHHFFTETKEAGICSFEDFQ
VVFIFDGLDECRLPLDFHKTKTLTDSRKSTSVDVLLINLIRGKLLPSAHLWITTRPAAAN
QIPPKCVSMVTEVRGFTDPQKEEYFRKRFRSTSSSKREVPHESEMCLLFILCEESNEMNC
WTSRPAGLGNRSLRHKHTFPAEHFQNSPTTRLQMITVTGVIEMRSSMSVYSHKTYADISS
SNPKCMKSQGKNILFQLLEDNIITFVKNELKKIQSFPYGFTNVSRHENHVFKEERGLYQD
EVFCFIHLSVQEFLAALHVHLTFINSGLNLLEEQQTRSMWSKLISKTKLKSLHQSAVNKA
LQSPNGHLDLFLRFLLGLSLQTNQTLLRGLMSQTGSSSQTNQKTVQYIKKKLSENLSAEK
SINLFHCLNELNDRSLVEEIQQSLRSGSLSTDKLSPAQWSALVFILLSSEKDLDVFDLKK
YSASEEALLRLLPVVKASNKALLSGCNISERSCDALSSVLNSQSSSLKELDLSNNDLQDS
GVKLLSAALQSPHCTLETLRLNHCDLSERSCEALSSGLSSQSCNLRELDLSNNNLKDSGV
KLLSEGLKSPHWKLETLSLSGCLITEEGCTSLASALSSNPSHLRELDLSYNHPGDSGMKL
LSAGLKDPGWRLDTLRVEPAGVRWLRPGLRKYSCQLTIDTNTVNTKLQLSDNNRKVTRVE
EVQSYPDHPDRFDYWAQMLCRNGLTGRCYWEVEWRGKVYISVSYRSIRRKGGSDCLLGYN
DQSWSLNCSDDAPRSVWHNNTQTSISSSSSSSSSVSNRAAVYVDCPAGTLSFYRVSSDTL
IHLHTFNTTFTQTLYPGFMVWPPGSSVSLC
Download sequence
Identical sequences I3K913
ENSONIP00000017608 ENSONIP00000017608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]