SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017673 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017673
Domain Number 1 Region: 168-229
Classification Level Classification E-value
Superfamily Bromodomain 0.0000000000000249
Family Bromodomain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017673   Gene: ENSONIG00000014060   Transcript: ENSONIT00000017688
Sequence length 2336
Comment pep:known_by_projection scaffold:Orenil1.0:GL831275.1:1827460:1843929:-1 gene:ENSONIG00000014060 transcript:ENSONIT00000017688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQGDMTEQITADVTDRDSALQQLASDIIMSSQSQKWVRSNAEDTGLGITEEGLSNGTCD
IDTVVALCCPGDTGDLTAEGDHLALSNDGMSEFSNSDLSLPEVCISTNSNTFEEDMNYEV
QQAYRIFNGFLLDKHKGITTPFLYPIGHQEAQHGIGGVKGRVQSQLRQSMCLRRMEEKFV
SQEYETITEFVADFRLMLENCYRYHGVDHWISKQAQKLEIMLEQKLTLLSRTLREKTTLA
VTSKGRFGAEEERGTGGTSTRRRSTPRSLATITVGGHESIMVQTLRLEEQQRAKEEKRQR
ELEKKEAEEMSAKEVEEWEQSLLSLAFPHTVETLWELPAIGHFLCLAQTALNLPEIIFFE
LERCLLMPRCSLLLSKIMSSLLSPPQRRATLHRRPTLPYRRWESELRQRVLGWYRAIGAS
RDQPGRAEQLGLCHQFFSTLGEASPLEDKPFHLLPFYQRVWLLKGLCDHVYETQKDVQDA
VLAQPIHECRESILGYDSKENAYIHFPHFCGADLRIYRQSPSTPPAFPFPSVWVKRVDFK
PGTEDESDGMRDEGNKSDRGCYGVSMETAETGDLGKRKRETFSVFKKENEKEEEDQKKFK
LWSLEQISESASSDGDSCEDSKLDLKIHTNSLRHTHNSPSEGGSVRIHLKQETLDVEQQA
KRITIKQEPGFSLGAVRTIKAETQEPCLNVGEHSYTGRSPARSVNLASPTKPLGVKMEGG
SPTQGHQRSPCFECCKKKTSSVKSEERGFCCGPSELVTQLSSESTQNSTEERANDKIWTK
KKKRKKKRGREQLLRVKGEHKQLQHVDRMRLSPAEAAKSTLRKVGTTIKRKDKKKKHKTG
KKPECSKKIKEEPSAEPSFKLVCTSLEELRELIGKTEDELDDLESTKKRLGRWYYRREAV
KDLHSTLIRLLNELSPWEPKLVKAHQRNRLRLKKEFDDFKTHPEYNNFVREESNLSSSDD
EDEERDLGKEVPSLSDHYGRSEEEDMENRVPRGLWSGASTRDIKVESAGENTVTCVPPNH
LKHPQASAEKGIGLRQKDQTVSSIISFADARSQSRSDLNPANQSRDSAWAERVTAHVSAP
PRSPILHPTIGLPKGYTPIPTLLAKSVGNKVTLMNRPSDCPGVNSEDEQSKRSLVSLPTT
AVANTKFSKAQSSPFSSQQNKQQIQVRGPQQTKAPEQSEVATVAAVLPKSPQGKPTQTAL
KNPVQVVYKVPEGLGHFVRKDNNSPIKISVQPVLGQDTGEKTVQQVVILPSNLLVHKTEA
KSCSLDQQQTKGFQATVSKVASSFCMSTDVPGFRIPENRIPVQQVAPLKDARTVKTPSPS
VSPRLQQGTLNTAGSKEARLCSVQASASQDTTPNTTSITAVSNTVCTATGKPTDPKQELK
TVCIRDSQSILVTTRCGNTGIVKVQTSSDQNALGSVHTSPVITISPQFKAFLLSKATQST
SAPSQTVPSVVQAMTTAQPQKQVHPVLKTPSSLKNTMLTATTGSIPITCSNSQTTVSAVA
VSQGLSTSTGSTVATNISQPVHTPAAGSHFQASLVKNSVAVPLQSGSGFSQAATSKTGMK
RTTTDEGSQVTKFILVTPSSSSSSNVAASKGTPSSPKPVPSSRLMFVTQPTLTSSATIIG
SLSAPAMATCASGQGATTSLSSQTLKVGLRPGKPASGISLEPLSKGKNITLPQGVQIQLP
GKAAIGQTTRALSQSSSRFTPGSVSNECGPTTSTTTTGLLPATSLNAITSCSSQLVSHGS
VSTSSHLQGLSASSLMSQTGCYTSINTAAAQPKGHMIKNDVNIPGSVVSVTTPVQTATTV
ESRPDRTSTLTLDCQRGIGEETTSSSSFSSSQFARNKTQLPLSSTATTCTPFTTSATSTI
QQRIVINTSTPLAAGTQILLNNARFVVPPQGLAPGSHVLIISSPAQQVPPASPTSTGPSV
PSQGASHAMVAPRVPVLPQPPARLPGVPAVSSPFVASTPAVVPPLLATTPNVLSLKLTGT
PGLGSNLLPSKTNVVSALPRLPTAHVGNFALPPVSTSTLVSPTARLDSVPTVPVVTSAPC
LGSAQGTVRLAAATQAKCLSTISPVVAPPLARLSGPLSLPVVPRPSPVTLPSPVIPVPAP
LSSAVAPVIADTPALHGSLPAQHVIAVTTLDLGIQPQQTAVRFAAPTTAQPQVLMHSGLS
STSIKKQTPLVQTVPAGTRTQVLPTVAVPPIISGVSRMQTLPIATVPPIGSTVNTFETAP
VETASSSSTTVIITPGQTMPSIKTNTTIYPPVVLTNQTLGKHSVQPSALGLHTSVTSKML
ISPDGAVLSTVQRPVSSAELTAPPEPRDALVICTNSSTGALQTHDSSLQPSTADTK
Download sequence
Identical sequences I3K978
XP_005470385.1.78416 XP_013132173.1.78416 XP_019216627.1.78416 ENSONIP00000017673 ENSONIP00000017673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]