SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017689 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017689
Domain Number 1 Region: 72-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.91e-22
Family G proteins 0.044
Further Details:      
 
Domain Number 2 Region: 659-719
Classification Level Classification E-value
Superfamily Fzo-like conserved region 0.000000000000196
Family Fzo-like conserved region 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017689   Gene: ENSONIG00000014073   Transcript: ENSONIT00000017704
Sequence length 721
Comment pep:known_by_projection scaffold:Orenil1.0:GL831416.1:700487:712233:-1 gene:ENSONIG00000014073 transcript:ENSONIT00000017704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAINPSPLRRFVIAKHSITSIFDQLLDFVKDGSAFVDEAWRSEDLGPVAVEEQSLEMQS
CAIKLTTIRDVLLRRHMKVAFFGRTSNGKSTVINAMLKDRVLPSGIGHTTNCFLSVEGTD
EDEAYLITEASTERRSVTTVNQLAHALHMDPTLDSGTLVKVFWPKSRCTLLRDDLVLMDS
PGTDVTLELDSWIDKFCLDADVFVLVGNAESTLMNTEKLFFHKVSEKISKPNIFILHNRW
DASVTEPDYIEEVRKQHLDRCVGFLADELKVVGLDDAAGRIFFVSAKEVLSARTQRAQGM
PETRETGGALAEGFHERLREFQRFERTFEEFISQSAVKTKFEQHTVRAWQITEAIKGVMD
AINIASADRKICCLEEREDLRDRLDFVRGQINRLSTSVKERIRTLSDDVTAKVSSALTDQ
IRSLPVLVDEFRADFSPTQETLLLYKTKLLQHVEERLIGGLDHRCSVGVLRDIRDAQSHM
IDAVRPLLSAALQEQLSTPSASFEITYDLGLAALCADFEENIDFQFSLGWTALVTRFIGA
SNAKRALSGADCAHKERSTFRDEMVVSIATGLVSVTSRASMTVLVIGGVVWRSVGWRLIA
LSVSLYGLLYLYEKLTWTDASRERALKQQFVEHAAQRLRAVVPVASNACSHQVCKELLST
FSRLTQRVELSDAELEGNIRQLSFRIQRLENIQRRSKAFRNRATELETQLEVFSVQYLQE
N
Download sequence
Identical sequences I3K994
ENSONIP00000017689 XP_013121487.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]