SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017884 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017884
Domain Number 1 Region: 7-288
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.92e-82
Family Protein kinases, catalytic subunit 0.000000000933
Further Details:      
 
Domain Number 2 Region: 368-664
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.87e-77
Family Ankyrin repeat 0.0000144
Further Details:      
 
Domain Number 3 Region: 1293-1412
Classification Level Classification E-value
Superfamily DEATH domain 6.02e-18
Family DEATH domain, DD 0.002
Further Details:      
 
Domain Number 4 Region: 680-709,781-890
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000182
Family G proteins 0.075
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000017884
Domain Number - Region: 687-753
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00945
Family Atu3015-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017884   Gene: ENSONIG00000014229   Transcript: ENSONIT00000017899
Sequence length 1448
Comment pep:known_by_projection scaffold:Orenil1.0:GL831164.1:4612385:4690664:-1 gene:ENSONIG00000014229 transcript:ENSONIT00000017899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVFNPENVEEFYDIGDELGSGQFAVVRRCRHRTTGVEFAAKFIKKRRSKSSRRGVTRED
IEREVNILKEIQHPNVIALHEVFENKAEVILILELVAGGELFDFLAEKESLSEEEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLNRSVPHPRIKIIDFGLAHKIDFGNDFKNIFGT
PEFVAPEVVNYEPLGLEADMWSVGVITYILLSGASPFLGDNKQETLANVSAVDYTFDEEF
FSSTSMLAKDFIARLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKESAVNMEKFKKFA
ARRKWKQSVRLISLCNRLSRSFLSRSNISVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLNSYDVNQPNKHGTPPLLIAAGCGNIQIIEVLMRKGAEIRAHDKSGANAIYYAA
RHGHVETLRFLHEKKCPLDVQDKSGETALHVAARYGNVDVVSYLCSIRANPDLTDREQET
PLHCAAWHGYSPVARALCQAGCHVDAKNREGESPLLTASARGFVDIVECLVEHGAELETT
DKEGHTALHLAVRRCQVEVVRCLLRHRCHVDQQDRHGNTPLHIACKDGNLPVVMAICNAK
ATLDLPNKSGRTPLHLAANNGSLEVVRHLCLAGANIDAVTNDGKTAEDLASADHHEHVVS
LLGKLKKDNHKLSYIQQLRPTQTVQPRIKLKLFGHSGAGKSTLLESLKCGILRSFFRRRR
TRMTNTTRHPNSPVNSKPPVSVSISNLYPGCENVSVRSRSMMFEPSLTKGVLEVFSPVHS
ALSAADEQATKAIDIQHANIHGVGDFSVWEFSGNPVYYCTYDYFAANDVTAIHVVLFSLE
EPYETQLGHITYWLNLLKALTLPQETISFGGRIQQPLAVVLVATHADLADVPRAFSGEFS
YNKERALLKEVRNRFGNDLQISDKLFVMDAGASNSKDMKLLRSHLQELRASIVSRCSPMT
LLSERLLAVLPTWRKLSGPNQLMSWQQFVSDVQEHINPLVSQDHLRTLALQLHSMGEINI
MQSETVQDVVLLEPRWLCSSILGKLLSVETPKAIHHYRGRYRLEEVQALAPESDVDELLQ
ILDAMDVCARDVTNPTMVDVPALIKTNGLHRSWTEEEEEDSLLYGGVRIVPAEHLTPFPC
GLFHKLQVNLCRWSHQQKPEEDGADDNDGDIHLWTNGAKASQAGVEAMILLVNHGQGVEI
QVRGHDSERAKCYTLLDTLCSITENLLASTLPGQLTAKYYLSPQQLREHHAPIMVYQPKD
FFRAQVQRETSLTNTMGGYRESFSSILAFGCAEIYQQGILGTDVHISDVPLLARRKLCRM
LDPPDAMGKDWCLLAMNLGLTELVAKYSSGTPNGTSELDSDTDSQQAALQPSPTAALLQE
WSGRAGSRVGVLMAKLRELGRRDAADFLLKASPVFKVNTEALGGAANGYPPTCNGGTSYN
SISSVISR
Download sequence
Identical sequences I3K9T9
ENSONIP00000017884 XP_005451613.1.78416 XP_005451614.1.78416 ENSONIP00000017884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]