SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018059 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018059
Domain Number 1 Region: 392-963,1015-1183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.1e-203
Family Motor proteins 0.0000000236
Further Details:      
 
Domain Number 2 Region: 64-303
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.67e-50
Family Ankyrin repeat 0.0000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018059   Gene: ENSONIG00000014363   Transcript: ENSONIT00000018074
Sequence length 1849
Comment pep:known_by_projection scaffold:Orenil1.0:GL831258.1:1460579:1541445:-1 gene:ENSONIG00000014363 transcript:ENSONIT00000018074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIDQCLLESLPIGQRQRLVRRMRCEQIRAYYEREKSLQRQQGGVKVRALPMHRKKHHVR
FRPADIIQDAIVHHNDKEVLRLLKEGVDPNTPISSGGSLLHLCARHDNVFAAELLIERGL
SVNLQDEDLWTALHVACVCDHADMVLLLLVAGVNVLLQDINGNIPLDYAIEGTETSYILR
KHLEENGVDVSSMHAMKIQRPSAMLSDVRQLVASGGSLNQPNEEGITLLHIACASGYREV
VSVLLQSRADPHPADNNFWTPLHLAAKYGQTSIVSQLLRHGANPTLLNCNQDKPYDIAVS
EPIADMLLNAEESWQQRLKDPSAPLPSTDQRYDSGSHDLNTPVKNLNPLGIPIAKRDSLL
EKCAMFREAAGALRRQPSQDNGLDSPFGSGASKLEQVKLMPPAPNDDLASLSELTDSSLL
YEMQKRFGNDQIYTYIGHILLLVNPNKELPIYSTLVSQLYLSSTGRLCSSLPPHIFSSAE
RAYHMMQQEKRPQCFILSGESGSGKTEACKHIVRHLTARSGAKGFMLEPRMKHVNCVLEA
FGHAKTQRNSNSSRFIKLLTIQYCDKRRTPLRAHVYTYMLEKSRLVHLPAQQHSFKIFYL
MAEGLSAEEKSALYLNNVLAHRYISGRLPGENPPVATASTQSREHLAAVKQALRALGFNK
QEVDSVFALLSAVLHIGDLRFTALTDADTAFPSDLQLLERAVAGLLQVSSSDLSTALTSD
VQYFKGDVITRRHTVEMSEQYRDQLAKAIYGRLFSYLVNNINDYLQGQDDTISDPAWEIG
ILDVFGFEEFQKNGFEQLCVNMTNERLRQYVSEVLFQQEQAECLQEGIAMENARSPRNHP
AILDFFFQKPQGLLCVLDEESQSLRPLEQTLYKRLSAQLDSNQIHGLSLTTKDGNGNPPP
KDQGPAFIVSHYAGQISYNLTGSLTKNKDSLPQNLLFTIKSSESVLLQQLFQSKLTQTGS
LVPAARSCIGLRGPKAALLLHRIPSVSLVSASSIPQQPRRYHDLTKILKKKGSSSFLQRL
ERCGPTTVAVQLRNTLSELVSKLQACTPHFVECVRPNSSCQPDNFDSFHVSTQLQYIGVL
EMVRMIRYGYPVRLSFPGFLSRYKDLVVPTLGDKKKLSPEEKCRSVLQQSKLQGWQMGSS
KVFLRYWQADQLNDRCYQLHKKIITCQKVVRGWLARQRVNRRLSLQHKEECGVQHFLQGA
EDMGLRTYDQLVIQNASDIARENDRLRCHAICRVAEKSTKVHEGPANGGSRVIRHFRSSS
VPTPLAIENMVHSSASPPIKPALQQVVHINEDGAGGGGLSSPRKQPPPKPKRDPNTRLSA
SYEAVSAGLTMAAKECSTPALSKPRPHSDDYTTMRKVPPPKPKRSPNTKLTGSYEEINAV
APQLHQLRPADVKLALLSRGGGFGGLMQRAASIDAPQGVALSLFKGQDEEDIYIEMLGSQ
QRARSLQEPPDSPEQADSEAVYEEMKYYPSEDGGAAASVTKPAKLEALGLNTSNSGAPKS
QHGKDGSCDIPAPFPNLLPHRPPLLVFPPSPVTCSPASDESPLTPLEVKKLPVFETNLNY
ATGPDSPLSPQYARQRADSSPSLTVLMPEKKSTPPLTPPPPPPPPSAPPPPYRPPSHFPF
PPEANFLALTRAASVTGSSDSSKTSSQRTGGEPLGKPPPYSPVKVSRPEPRRAHSCSSSP
LLFNPANGRPLTSPLDELNTLFSSGRSLLRKSGRKMRDGVIFPPGFNSNINLPGREDCGS
APTSPSLQLQDKNANNHSPHSQSPAPVENGNQISNGSLEDESHSKSNSSSTPSLHRHMDS
HHTQVFQRLRLSNGDESAALGELLRWRRLQCEGRSDWKRRPPQSPPLPP
Download sequence
Identical sequences I3KAB4
ENSONIP00000018059 ENSONIP00000018059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]