SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018321 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018321
Domain Number 1 Region: 3-164
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.85e-54
Family G proteins 0.0000000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018321   Gene: ENSONIG00000014560   Transcript: ENSONIT00000018338
Sequence length 189
Comment pep:known_by_projection scaffold:Orenil1.0:GL831142.1:768978:783871:-1 gene:ENSONIG00000014560 transcript:ENSONIT00000018338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD
CMSCRCVVS
Download sequence
Identical sequences A0A087X9L5 A0A0F8AVD2 A0A146NBL3 A0A1A8HRY4 G3PBL5 I3KB26 M4AL20 Q4PJW4
XP_003440453.1.78416 XP_005471058.1.78416 XP_005808894.1.87360 XP_007571836.1.10163 XP_008310555.1.100486 XP_008310556.1.100486 XP_008310557.1.100486 XP_008409755.1.1237 XP_010731031.1.61708 XP_010731032.1.61708 XP_010881986.1.71217 XP_014841707.1.96476 XP_015820324.1.37898 XP_015820325.1.37898 XP_015820327.1.37898 XP_015820328.1.37898 XP_015820329.1.37898 XP_015820330.1.37898 XP_015820331.1.37898 XP_015820332.1.37898 XP_017278554.1.84151 XP_017577999.1.86671 XP_018519847.1.34915 XP_018519848.1.34915 XP_019217488.1.78416 XP_019749552.1.30352 XP_019957741.1.63745 XP_019957742.1.63745 XP_020474229.1.23826 XP_020474230.1.23826 XP_020497610.1.8198 XP_022045643.1.10920 XP_022045644.1.10920 ENSONIP00000018321 ENSONIP00000018321 ENSXMAP00000015164 ENSXMAP00000015164 ENSGACP00000014989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]