SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018400 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018400
Domain Number 1 Region: 33-251
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-66
Family SPRY domain 0.0000000143
Further Details:      
 
Domain Number 2 Region: 240-277
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000314
Family SOCS box-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018400   Gene: ENSONIG00000014616   Transcript: ENSONIT00000018417
Sequence length 278
Comment pep:known_by_projection scaffold:Orenil1.0:GL831360.1:398492:412139:-1 gene:ENSONIG00000014616 transcript:ENSONIT00000018417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKISGTIKSVDVRGEPSYRPVRRELRGPDFCRPPRLDLLLDMPPASPETQLQHAWNPD
DRSLNVFVKEDDKLTFHRHPVAQSTDCIRGKVGYTRGLHVWRIHWPARQRGTHAVVGVAT
AEAPLHSVGYTALVGSDSESWGWDLGRNRLYHDGKNRPVSTSAPTYPSFLEPDESFVLPD
CLTVILDMDEGTLSFMVDGQYLGVAFRGLKGKRLYPIVSAVWGHCEVSIRYVNGLDPEPL
PLMDLCRRVARLALGRERIHHIDTLPLPQTLKNYLQYQ
Download sequence
Identical sequences I3KBA5
XP_005461765.1.78416 XP_019223263.1.78416 XP_019223264.1.78416 XP_019223265.1.78416 ENSONIP00000018400 ENSONIP00000018400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]