SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018461 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018461
Domain Number 1 Region: 515-948
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.65e-55
Family Tandem AAA-ATPase domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018461   Gene: ENSONIG00000014663   Transcript: ENSONIT00000018478
Sequence length 1004
Comment pep:known_by_projection scaffold:Orenil1.0:GL831272.1:240165:254746:1 gene:ENSONIG00000014663 transcript:ENSONIT00000018478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLKDSLESGLDFIEFLGDRVSSISKKELKVIYNSKFRGRKGIKDPNFSNVFFALVKFN
KAQIRQGQVYINARPQVRVYCDQWRRPRAPQPQNLGSGPQTPAGTPAGSSTPVAPVLTPK
KKLASEILRKLKVNRKELTADKGGIEITSDPVESGGKVQFTVDRLREPFVVRFHIVNKGT
DCIHLTYYTALHRIRCFTLEDERRVTRASPLFLCPGESYEVKVKYILNHYGYFPATMYFE
FCPDLPGSVPFCIVREIEAAAQTPLAVELGPVAPYKPFRVAAYKPVDTIIVDGVPPDSSV
VPLKMAVKLGDYKYHNDLKDLAKRRMEDSEYLSPTAKQKLASVKGLLSCPLKMKNYSHRF
HLLLHLEEIQMEVDIRKYDLHNQTMTEDQGNKKLLKLRVPGVAENRPSVLRGDCLRVSKS
EDTVQPITVYTGYVHRVELDSVTLGFSKKLLQLFISNMKFNVEFTLNRYPLKLQHRAVDL
AVKHQLEEVLFPSGAAVASVPMPKLRMFNRQLENNPEQHAAVQRIVAGSSKPAPHLVFGP
PGTGKTITVVEAINQVSKADPSAHILACAPSNSACDLLCERLKVNMDSHQIYRVYANSRD
PNSIPKSLLKYCNWDKSKDSFVPPQKEVTMKYKVVVTTMVTAGRLVSGGIPVGHFSHVFV
DEGGQAVEPECVIAIAGLLDAEKGQLVLAGDPKQLGPILRSPFAIEHGLGLSLLERLMRH
NSLYQKNTDGHFDTRFVTKLLRNYRSHSAILKIPNELFYENELQVFADQWERETYCNWEY
LPKKGFPVIFHGVMGKDEREANSPSFFNVSEIEVLIDYLTKLMETQGKKGLPKLSATDIG
IIAPYRKQVEKIRKALRLVPALSRWSDLKELKVGSVEEFQGQERKIIMVSTVRSSINYVK
MDTDFNIGFLSNEKRFNVALTRARSLLIVVGNPVILKKDPTWEKFISYCVKEKGYTGFDF
SDAEGEDDIVSRLATLKISMDSECPVPEESAIQQFVDPGWKNEH
Download sequence
Identical sequences I3KBG6
XP_003453727.1.78416 ENSONIP00000018461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]