SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018610 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018610
Domain Number 1 Region: 32-61,179-349
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.42e-63
Family G proteins 0.0000000178
Further Details:      
 
Domain Number 2 Region: 61-181
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 8.11e-43
Family Transducin (alpha subunit), insertion domain 0.000000732
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018610   Gene: ENSONIG00000014782   Transcript: ENSONIT00000018627
Sequence length 354
Comment pep:known_by_projection scaffold:Orenil1.0:GL831142.1:3067375:3079469:1 gene:ENSONIG00000014782 transcript:ENSONIT00000018627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCTLSTDDKAAQERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFADQARADDARQLFVLAGSAEEGFMT
SELAGVIQRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISNSAYVPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICFPEYAGANTYEEAA
AYVQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
Download sequence
Identical sequences I3KBW5
ENSONIP00000018610 XP_003440415.1.78416 XP_004553440.1.88231 XP_005470970.1.78416 XP_005745991.1.53837 XP_005934248.1.24487 XP_006789577.1.46954 XP_006789578.1.46954 ENSONIP00000018610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]