SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018616 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018616
Domain Number 1 Region: 1216-1308
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-25
Family PDZ domain 0.0000252
Further Details:      
 
Domain Number 2 Region: 421-524
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-25
Family PDZ domain 0.00000885
Further Details:      
 
Domain Number 3 Region: 917-1022
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-23
Family PDZ domain 0.0000177
Further Details:      
 
Domain Number 4 Region: 771-879
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-22
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 5 Region: 622-715
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-19
Family PDZ domain 0.00019
Further Details:      
 
Domain Number 6 Region: 125-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.48e-16
Family Nucleotide and nucleoside kinases 0.0063
Further Details:      
 
Domain Number 7 Region: 9-105
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000868
Family PDZ domain 0.03
Further Details:      
 
Domain Number 8 Region: 306-344
Classification Level Classification E-value
Superfamily WW domain 0.000000000000401
Family WW domain 0.0011
Further Details:      
 
Domain Number 9 Region: 349-390
Classification Level Classification E-value
Superfamily WW domain 0.00000000584
Family WW domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018616   Gene: ENSONIG00000014787   Transcript: ENSONIT00000018633
Sequence length 1360
Comment pep:known_by_projection scaffold:Orenil1.0:GL831142.1:3085768:3172750:1 gene:ENSONIG00000014787 transcript:ENSONIT00000018633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSLKKKNHWTNKVHEAVITRGKEGELGFELKGGAENGQFPYFGEVKQGKGLIQSGKLA
QDELLLEVNDMPVAGLTTRDVLAVIKHCKDPVRFKCVKQGGVVDKDLRHYLNLRFSKGSV
DHDHQQIIRDNLYLRTVPCTTRQPKEGEVPGVDYNFVSVERFMELEQSGALLESGTYEDN
FYGTPKPPAEPSPAAPPLNVSEALLPGARPSAQGKRKRNQSVSNMEQRASLEPPEEEEEE
SPVVNGNGVAITPESSEHEDKSTDASGEVAVEASIQAPASAEPPTEEEEAPKSPCKSPTK
VLDADEEELGPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECREDELPY
GWEKIDDPIYGSYYVDHINRRTQFENPVLEAKRRLEQQRQMQSQGLSALPLPTIYREKPL
FTRDPTQLKGTFLSTALQKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMDTGDV
IVYINDICVLGTTHADVVKLFQSVPIGQSVTLVLCRGYPLPFDPEDPSGAASASLTPIGL
EHRPLVVNGRGSYDPYLEYLSLSSQLPGQALAQAGASHPGDTHLDGSSLPPTTPGSASAL
TPHNDNVSMASSGTGAVAGATAQGAELLTVTMVKGAEGFGFTIADSPTGQRVKQVLEPGS
QGASGLVEGDLILEVNQQSVAAAGHGRVVEMLKECPVGAEATLLIQRGGTGHISPWKASK
QLPDQWDPHSSPQANLSGPVLPPGTPFPNQPQHRTSVPDSTEGFDLNKPDPYDLYEKSRA
IYESRRPEYEEVEVHLLREKTGFGFRILGGDEAVQAIVIGAIIENTPAERDGRLRPGDEL
ISVDKNVVAGKPHKYVIDLMHAAARNGQVSLTVRRRVQMPGEPCPVNGRSPGSVSTQHSS
PRSDAASASGPPVVAATVATSPPEGSALQTSDVVINRKENEGFGFVIISSLNRPENATVI
TVPHKIGRIIEGSPADRCGKLKVGDRILAVNGQSIISMPHADIVKLIKDAGLTVTLHIIP
EESSHSGPSSEKQSPMTQKHSPQTQPSPVAQTSQGGTQSGQMAAQPGQAATQPGQAPGQT
PVQPGQTPAQTNQAVTGPPAPAGTQQSPVTQPSGPHPQLYLHDGRSEVKARQDVKPDFRH
PPFTDYRQPPVDYRHPPVTDYRQPPTLDYRHPPGLLDFRQHPAAAQFPLGIPADFRPQVE
LDQELSAYVDRTSFICMQDYDYFTVELEKSAKGFGFSIRGGREYKMDLFVLRLAEDGPAI
RNGRMRVGDQIIEINGDSTRDMTHARAIELIKAGGRRVRLLLKRGTGQVPEYGMVPPNLS
MCMKGDTLSSPYFFLMGHSKDTTVPAPGIPFLQPTLPCRK
Download sequence
Identical sequences I3KBX1
ENSONIP00000018616 ENSONIP00000018616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]