SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018656 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018656
Domain Number 1 Region: 140-384
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.28e-62
Family WD40-repeat 0.00024
Further Details:      
 
Domain Number 2 Region: 380-424
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000602
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018656   Gene: ENSONIG00000014818   Transcript: ENSONIT00000018673
Sequence length 427
Comment pep:known_by_projection scaffold:Orenil1.0:GL831426.1:490442:514281:-1 gene:ENSONIG00000014818 transcript:ENSONIT00000018673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFPDSVNENDIGKAKFIGELLVPVAPFDQKSGREAWTVAFAPNGSYFAWSQGHRIVRL
IPWTKCLDSFSVGHGEEGTNALSPRHLSRQSSDGGQVVPAAGQPPEHTIDCGDIVWGLAF
GSSVPEKHSRCVNIEWHRFKFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLMDHTDVVRD
LTFAPDGSLMLVSASRDKTLRVWDLKDDGNMVKVLRGHQNWVYCSAFSPDSSILCSVGAG
KSVFLWNMDKFTPIRKLEGHHHDVVSCEFSPDGALLATASYDTRVIVWDHDKATILLELG
HLFPPPSPIFAGGANDRWVRSVSFCPDGRHIASVTDDRLVRFWSIEERAPLAIASVSNGL
CCAFSAQGSVLAAGTRDGSVHFWECPRSIASLQHMCRMALRRVMSTQQVEALAIPALLCD
YLTYKVI
Download sequence
Identical sequences I3KC11
XP_003458371.1.78416 ENSONIP00000018656 ENSONIP00000018656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]