SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018723 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018723
Domain Number 1 Region: 858-1035
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-47
Family SPRY domain 0.0014
Further Details:      
 
Domain Number 2 Region: 592-850
Classification Level Classification E-value
Superfamily RNI-like 1.35e-46
Family 28-residue LRR 0.0000985
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000018723
Domain Number - Region: 152-337
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00345
Family Extended AAA-ATPase domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018723   Gene: ENSONIG00000014874   Transcript: ENSONIT00000018740
Sequence length 1041
Comment pep:novel scaffold:Orenil1.0:GL831767.1:63874:98888:-1 gene:ENSONIG00000014874 transcript:ENSONIT00000018740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLEDNIITFVKSELKNIQMVLNPDYPECLKSQREDGEELESEAREQIRTSREAFMKITL
NFLRKMKQEKLADYLQNKHAAVCQRALKFSLREKFQCVFEGTPKAGNPILLNQIYTELYI
TEGGITEVSREHEIRQIETASMTPDRPETTIKLVDLFKASHARKQPVRTVLTKGVAGIGK
TVLTQKFTLDWAEGKANQDIQFIFPFNFRELNVLKEKRFSLVELVHHFFTETKEAGICSF
EDFQAVFIFDGLDECQLPLDFHNTDVLNDPRKSTSVDVLFINLIRGKLLPSSHLWITTRP
AAANQIPPECIDMVTDIRGFTDTQKEEYFRKRFRDEEQASRIIFHIKTSRSLHIMCHIPV
FCWIIATVLEDVLKTRERGELPKNLTEMYIHFLVIQAKVKKVKYDGGAETDLHWSPESRT
MIESLGKLAFDQLQKGNLIFYESDLTECGIDIAAASVYSGVFTQIFREERGLYQKKVFCF
LHLSVQEFLAALHVHLMFFHSGVSLLEVQEATSRFSETTKETRFYKNAVKKALKDPYGHW
DLFLRFLLGLSLQTSQTLLQGLLTQTVSASQTNQTVVQYIKEKLSQNLSAEKSINLFHCL
NELNDRALVKEIQWYLRSGRLSADKLSPAQWSALVFILLSSEKDLDVFDLKKYSASEKAF
LRLLPVIKASNKALLNLCNLSESSCEVLSSVLTSQSCSLRELDLSSNDLQDSGLKLLSTV
LESPYCKLQSLRLTSCYLTERSCEALSSVFISQSFRLRELDLSNNDLKDSGGILLSAGLK
NPHCTLKSLSLSGCLIAERGCISLASALSSNPSHLGELDLSYNHPGESGMKLLSDGLKDP
LWRLETLRVEPSGEQWLRPGLRKYSCQLTIDTNTVNRNLKLSDCNSKVTHVEEVQSYPDH
PDRFDYWPQLLCRDGLTGRCYWEVEWKGLAYISVSYRRIERKGDSRDCTFGFNEKSWSLS
CCDDGPPSVSHNKKVTFISSSSSSSVSNRVAVYVDCPAGTLSFYRVSSDTLIHLHTFNTK
FTEPLYPGFTVWFPGSSVCLC
Download sequence
Identical sequences I3KC78
ENSONIP00000018723 ENSONIP00000018723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]