SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018746 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018746
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.08e-51
Family G proteins 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018746   Gene: ENSONIG00000014892   Transcript: ENSONIT00000018763
Sequence length 207
Comment pep:known_by_projection scaffold:Orenil1.0:GL831175.1:3765479:3773282:-1 gene:ENSONIG00000014892 transcript:ENSONIT00000018763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEHLLKILIVGDGNVGKSSFVHRYVSGQFNKTYKMTVGVDFSVKLLRWSDKEKVRLQLW
DIAGQERFISMTRIYYKGALGCVVMFDVTSSSSFSSCRHWKQDLDNKAMLPNGDSIPCIL
VANKCDLAHRAVSADTIDKFSKAHGFITWMETSVKDNKNVEEAMRMLAQEILSVQSTMDP
IHRPEFRVYPHPDSEFNRSSGEGRGCC
Download sequence
Identical sequences I3KCA1
XP_019204817.1.78416 XP_019204818.1.78416 XP_019204819.1.78416 ENSONIP00000018746 ENSONIP00000018746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]