SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018774 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018774
Domain Number 1 Region: 38-67,184-353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.96e-58
Family G proteins 0.0000000161
Further Details:      
 
Domain Number 2 Region: 67-186
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 4.71e-43
Family Transducin (alpha subunit), insertion domain 0.000000622
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018774   Gene: ENSONIG00000014912   Transcript: ENSONIT00000018791
Sequence length 359
Comment pep:known_by_projection scaffold:Orenil1.0:GL831176.1:172592:192306:-1 gene:ENSONIG00000014912 transcript:ENSONIT00000018791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGTGYSDEDKRGFTKLVYQNIFTSMQAMIRAMETLKIPYKYEHNKAHANIVREVDVEK
INKFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNSLDRIAETAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAGREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
Download sequence
Identical sequences I3KCC9
XP_003446097.1.78416 ENSONIP00000018774 ENSONIP00000018774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]