SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018956 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018956
Domain Number 1 Region: 656-740,781-947
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.12e-58
Family Tandem AAA-ATPase domain 0.0000948
Further Details:      
 
Domain Number 2 Region: 419-654
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-55
Family Tandem AAA-ATPase domain 0.0001
Further Details:      
 
Domain Number 3 Region: 191-243
Classification Level Classification E-value
Superfamily UBA-like 0.00000000878
Family CUE domain 0.073
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000018956
Domain Number - Region: 331-369
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000711
Family ComEA-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018956   Gene: ENSONIG00000015059   Transcript: ENSONIT00000018973
Sequence length 961
Comment pep:known_by_projection scaffold:Orenil1.0:GL831176.1:2308234:2320234:1 gene:ENSONIG00000015059 transcript:ENSONIT00000018973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLFNLDRFRFEGRPCSKDQVNGSKSLESEKENKPARTKPVKAPPKSHARGVVFEEVFTV
DLEEDEVISEPKTKISLTKKSNKPAGKASQTVVLDDTDNELDDKLNRLIEMFPQLTRPDA
LEIVESTSTLDGAVAACLLKYGDKEAPSQSRKRKQDGSSSSKDSVEIQPSKKTKPSANGQ
ASDEEEDEDKELSWEKQESMVRRLQKKFPDQDKVELRMVLQEHDWNFEDALQVLQMFTDT
DNTSFSSHGSEGKVSSKSKKKDKSKRKLSHQEDQKNGEKRQDYEEFEDHVSETEDDSTDD
SDNTKDSEDDSDLEDNEDSKKKEILAFFRDASLDELSLMSGCSIKKAQKIVELRPFNSWK
SLVEALNKNNGLSEDLLLGCRVVLKERKVVLGLMSKCETISSKMVKQVTQVMEKGTGAMK
QPRVLNTQFQLKPYQLIGLKWLLLLHEHKLSGILADEMGLGKTIQAIAFLAQLYQNGIEG
PHLITVPSSTLDNWVREMKLWCPDLKVLVYYGSIEDRRYLKHDILNGDVDFNVIVTTYNL
AIGNDSDRSLFRKLQLKYAIFDEGHMLKNMNSLRYRHLMAINTEHRLLLTGTPLQNNLLE
LMSLLNFIMPSMFSSSTTQLSKMFSMKSHEEQSRFERDRISQAKLIMKPFILRRLKSEVL
QQLPAKEEKVEFCSMSEKQQGLYQNLFQKLKSTTNGESIFSSERELCNVMMQLRKMANHP
LLHRQYYTTEKLKAMSKLMLKEPTHFDADPVLIQEDMEVMSDFELHRLCQQYSTISSYQL
ENDLLFDSGKFHHLTKLLASLKEKGDRVVLFSQFTMMLDIVEVLLKHLMHRYIRLDGSTP
IADRIVLIDEFNTDPDIFVFLLSTRAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHR
VGQTRTVQVIKLISKDTIEDCILQLGNKKLKLEQDMTSSEQSVEGTIPEDMASLIKASLG
L
Download sequence
Identical sequences I3KCW1
ENSONIP00000018956 ENSONIP00000018956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]