SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019192 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019192
Domain Number 1 Region: 138-420
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-102
Family RecA protein-like (ATPase-domain) 0.000000000129
Further Details:      
 
Domain Number 2 Region: 423-550
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 3.14e-45
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000078
Further Details:      
 
Domain Number 3 Region: 52-136
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 3.14e-27
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019192   Gene: ENSONIG00000015251   Transcript: ENSONIT00000019209
Sequence length 551
Comment pep:known_by_projection scaffold:Orenil1.0:GL831176.1:4411392:4415712:1 gene:ENSONIG00000015251 transcript:ENSONIT00000019209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVRVAAALARTLPRRAGFVSKTIPAACVGVNHLHTHRPWLQKTGTAEVSSILEEKILG
ADTSSDLEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGN
DKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPLGSKVRRRVGLKAPGIIP
RISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGTDEKKK
LYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFR
DNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDNFGG
GSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAA
QTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYSPMAI
EEQVAVIYAGVRGHLDKMEPSKITKFEKAFLQHILSQHQDLLSNIKADGKISEASDAKLK
QIVLNFLSSFE
Download sequence
Identical sequences I3KDJ7
ENSONIP00000019192 XP_003446142.1.78416 ENSONIP00000019192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]