SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019227 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019227
Domain Number 1 Region: 1520-1684
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000182
Family Nucleotide and nucleoside kinases 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019227   Gene: ENSONIG00000015280   Transcript: ENSONIT00000019244
Sequence length 1829
Comment pep:known_by_projection scaffold:Orenil1.0:GL831316.1:91366:113447:-1 gene:ENSONIG00000015280 transcript:ENSONIT00000019244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYPTWGNYGAPQSQNYGGAGPRKPLAGSHTGQAPGFGGFEASSSGSLFSSLQEQHLQQMQ
QLQMLHQKQLQSVLQHGSNASTAAPAYGVAHTGGYMGSSWRPEGPAHVDSGAGAQSYFKP
EETPATRVPPSPKQGHQQPPPLPPQPHPTDTQPVPPPPEPQPSKPPDNSVPPKSKEAPTA
EDEKSLPLQYLTGKHHSTQASEEYNRSVFLKLPPSKYPELFNLTYTFKTKVMDCGHRQKF
VFLQPNESNADDFLVYPQEQQQLWYKQHLQNLQKLKQERAKQNQKDGDGSFPLPPPPGKT
APPPPPLEPPKSTPPPPPPKEEPPTPPPLPEEPEVPKDPEEAARLQQLQAAAAHWQQVQQ
QRAGLQYQALMQQHEKLQQILEQYQRLIQQPANLQERVATLTAMVPFASSQYNSGMMGQY
GQYPVQDMPLQQSVNPGMQQTPVTVGPRLQGPQPTGFVTHSESPAVPSVRGSAPSGIGVQ
APVPPVVQPPSFNNVRGPRPPRFDHPQQRFDGPPRFDQPQNRFDGPPRFDQPRHRFDGPP
RFDQQRQRFDGPPRFDQPRFGQPPRFDSTRLTGPSPRLECPPKLQDKQQQGMLPKVEPVT
PQPPTPDSKTPEKSSDKPLSENEKDKLKSVDKSASEDMTDDNLLSTEGFFVQSDPIPQTL
QTDTKPENSNGSVTLDKGEKPEPVNSKPSVNTSSAVTSNTTTQNSLKPDGPLGSSKPPQI
PKSSGIQPEPQKQSKLDPPKPPPGRGRGQPPVPSQVRGRGRGQRSSGGPHMGRGGPLMMR
GRPPMPRGGPPMGRGGPPMGRGGPPMGRGGPPMGRGGPPMARGGPPMARGGPPMARIERR
PPMRGMRPPFPPGRGRPPRGHPGFMLQGRGRPPFPPHGPIDHEPLGHGMESDDSNMDPSR
HPMYHGHEPPSHAMHPDVGRGRRRVPPSPHEMIDHLEEPMYDEGTEGELDWQPPPGRGPP
PPPHEILDREGLRRRPMGRGIGRGMWRPGPTHEDYEEGYKEGYAVDYDHGEDGYRRRPPP
DYLPDDCRRDARYHESEWDREHALPERDYPPRKAPSEPFREPHWQEERERGHPYQYDELE
RGRGELRIREYRDEPPYRKDEPPYPPPSEWDRPSRRPPLPERGYPIDYEDRRPRYEEQRE
EIPLHIPPPAAAPVTNLPESSVEAASGANVLALSQRQHEIILKAAQELKLISKQKPASSH
VIYNYFIFLGLKKINSFRVHRELQEGKTSGSESKPAQTDVLPDLPAGLLGLEIPPEVRNV
LKVNKNDQLYYFRLLGQICSQGMTATTQTTAAESVPLDIKSTATHYQPSFPTAPAVPVIP
KTVDYGHGHEPGATVERISYGERIVLRPDPVPSDRGYEKVHEPLRDPYGRDPYYERRSDP
YMDRREYSRERELYREKPEYERERFDRERYPLRERDDSTQAMNDERDRSGSRDPDEHYGR
PGYDRPPYERATLERTGPERYSHSPSPYIVDRRSYPDDRGPPTAPPIPPPQPPPRVEKKP
EIKNIDDILKLPGRLSRPERIVIIMRGLPGSGKTHVAKLIRDKEVECGGAPPRVLVLDDY
FMTEVEKVEKDPDTGKRVKKKVMEYEYEPEMEDTYRSSMLKTFKKTLDDGFFPFIILDTI
NDRVKHFDQFWSAAKTKGFEVYLAEITADTQTCAKRNVHGRTLKDIMKMSNNWEPSPRHM
VRLDVRSLLQDAAIEEVEMEDFNPDDEPKEPKREEEEESDLGYIPKSKWEMDTSEAKLDK
LDGLGSGGKRKREGEHMAGLEDYLQLPDDYATRMSEPGKKRVRWADLEEQKDADRKRAIG
FVVGQTDWEKITDESGQLAQRALNRTKYF
Download sequence
Identical sequences I3KDN2
ENSONIP00000019227 ENSONIP00000019227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]