SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019311 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019311
Domain Number 1 Region: 274-529
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000381
Family RNA helicase 0.084
Further Details:      
 
Domain Number 2 Region: 938-1045
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000604
Family Tandem AAA-ATPase domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019311   Gene: ENSONIG00000015348   Transcript: ENSONIT00000019328
Sequence length 1403
Comment pep:known_by_projection scaffold:Orenil1.0:GL831304.1:339159:355817:1 gene:ENSONIG00000015348 transcript:ENSONIT00000019328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGQDLLLAALSESGICPNDIGLFDVDSQDVAQPSTTQQSISISALDVGVGVGTESVEV
VRPEHPAAVPIVTIRHKPQPSTTTFVLNQLNQLPPLGAVVTKQSAINPVKHTITVTKVVH
VANSTLRSSSAPSSTSIPPSASTVVPSNRDQQIQLKDLLRSSSVKSTGLKGNSLIELMKL
KPPPDIAPPVATATATGPGDLNNGIKREVLGKDSARIWIHDDIKLQTFPHSLKPPVVKEE
DEPEEEEEDELGHAETYAEYMPQKLKVGLRHPDPVVETSSLSSVSPPDVWYRLTIPEEVI
DRGCLSALQLEAITYAAQQHETFLPNGDRAAYLIGDGAGVGKGRTIAGIIYENYLLGRKR
SLWFSVSNDLKYDAERDLRDIGAKNIQVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLI
GESQSGGKYKTRFEQLLHWCGEDFDGVIVYDECHKAKNVCPIGSSKPTKTGLAVLELQNK
LPKARVVYASATGASEPRNMAYMNRLGIWGHKTPFREFGDFIQAVERRGVGAMEIVAMDM
KLRGMYIARQLSFTGVTFKIDEVPLTQEYINMYNKSVRLWVSARERFQQAANLMDAEQRM
KKSMWGQFWSAHQRFFKYLCIASKVRRVVQLAREEVQNGKCVVIGLQSTGEARTLEALEE
GGGELNDFVSTAKGVLQSLIEKHFPAPDRQKLYSLLGIDLSAKKTPSPSDTAVEQEQKGK
KRKGSEVKKQQKKRPRKHGGLSGTSSDESQSEESDRDCDSDDSFKSVSSADEDDDFNPFR
EESDDDDDPWLNRKEPKKGKEKKKKKRRKSIDPDSIQSALLASGLCSTRPTFTASVNPPS
TPATVKADSQESCLTSQDSVELAQKMKKELLEKLEDLAEDLPPNTLDELIDELGGPENVA
EMTGRKGRVVSNDDGTITYESRSELDVPVEILNLTEKQRFMDGEKNIAIISEAASSGISL
QADRRVKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASI
VAKRLESLGALTHGDRRATETRDLSRFNFDNKYGRNALEIVMKSIVKLDTPLVSPPSDFK
GDFFKEIQIGLVGVGLINVEDRSGTLSLDKDYNNMGKFLNRILGMEVHQQNALFQYFSDT
LAAVIQEAKKNGKYDMGILDLGSGDEKVKKVDCRKFLTPGYTTSGHVELYTVSVERGMSW
EEATHAWADQNGADDGFYVQMRNNKKTAILVKEVNTKKRLFLVYRPNTGRQVKLETYTDL
KKKFKKVLSEDAKQHWTDQYKSSEKICSHAYWRGNCKKASVGLQCEVGLRCRRYYVLCGS
VLSVWNELEEVLTPVSGTNVKVQIVRLRTEDGQRIVGLIIPANCVSPLINKLSTSDQCQQ
LAVQEQQKRQQLHPQSLSHTHHT
Download sequence
Identical sequences I3KDW6
ENSONIP00000019311 ENSONIP00000019311 XP_005459708.1.78416 XP_005459709.1.78416 XP_013132998.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]