SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019514 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019514
Domain Number 1 Region: 186-621
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.73e-70
Family Tandem AAA-ATPase domain 0.012
Further Details:      
 
Domain Number 2 Region: 865-935
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000000196
Family AN1-like Zinc finger 0.0026
Further Details:      
 
Domain Number 3 Region: 714-780
Classification Level Classification E-value
Superfamily R3H domain 0.0000000000000785
Family R3H domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019514   Gene: ENSONIG00000015506   Transcript: ENSONIT00000019531
Sequence length 977
Comment pep:known_by_projection scaffold:Orenil1.0:GL831142.1:8469912:8479896:-1 gene:ENSONIG00000015506 transcript:ENSONIT00000019531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALEKFVSKTLELLQEEREAEIEETRVWQENISLKDLQNKGVCLLKLQIGSQSTGLYGRT
VVILEPRKHLGFSSLPSNSFGPGDIVGLYDTTGCAAASQISTGIVTRVGQASISVAFDDL
KDGHSFDSDALYNLLKLANDVTYKRMKRALNTLNGYNNGPASNLISVLFGDTKPTSQSQP
NKVEFFNSNLDDSQREAVSFALSQRELAVIHGPPGTGKTTTVVEIILQAVKHGQKVLCCA
PSNVAVDNLVERLAQCKAKVLRLGHPARLLESIQKHSLDAILAQSDNANIIAEIRKDIDK
AFTGMKKEKGERGNLKREIGELRKELKNRETAAIAQILKSADVVLSTNTGACDDGPLKFL
PAEHFDWVVIDECAQALESSCWIALLRARKCILAGDYKQLPPTIKSQMAASKGLSLSLME
RLIQMYGDSVVRMLTVQYRMNSAIMQWASKEMYQGRLTAHSSVEGHLLKDLAGVACVEET
STPLLLIDTAGCGLSEMEVADEQSKGNTGEVDIVDLHIKALTEAGVKAKDIAVIAPYNLQ
VDLLRQKLSAKHPELEIKSVDGFQGREKEAVVLSLVRSNRKGEVGFLAEDRRINVAVTRA
RRHIAVVCDTQTVQNHGFLKSLIDHMTEFGEVRTAFEYIQDIVPQNYTRDHKDAKTASSS
TSTSTKHKVKDQPSSKAKPGQKKSAGSSSKENATGSEKQAKSSTSAEQEQSKGRRAEIRE
QVERFMKNLNQSELQFPSSFNSHDRLLVHEIAEELGLIHESKGEGSERCITVSRPPVSKP
AKEEARAATEEEEETVPDSKSEPSSQPPLDLKSLHLERMKREQQKREENAQQKKQQNNIH
PPQGHSSKKAKGLHQKRLNKAFKDDDFDTLISSVMKADSVCSFVKCKASVLTLGQLCLFC
NRQYCLSHHIPEVHGCGDKAKSHARMRISKEGILYAGSGKKDKSMDPNKKAYLQRKLDSK
LKDMASQRKPKNKEKDG
Download sequence
Identical sequences I3KEG9
ENSONIP00000019514 ENSONIP00000019514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]