SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019540 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019540
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-35
Family G proteins 0.0000846
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019540   Gene: ENSONIG00000015529   Transcript: ENSONIT00000019557
Sequence length 205
Comment pep:known_by_projection scaffold:Orenil1.0:GL831310.1:474865:482161:1 gene:ENSONIG00000015529 transcript:ENSONIT00000019557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDIKLALLGSQGAGKSAVLVRFLTRRFIGEYASNTNSLYHKRLSIDGRQLNLEVFDPCS
QGSEARCILEEPVDWADGFVVVYNISDRTSFINAKNILRQIRETRMENCKGEMDVPVCLV
GNKQDLCHARQVREDEGRGLAQENRCNFQEVSAAESYQDIANLFTQLIRRVMEHLKYRAD
RRRYSGSKSMAKLINNVFGKRRKSV
Download sequence
Identical sequences I3KEJ5
XP_013119670.1.78416 ENSONIP00000019540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]