SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019591 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019591
Domain Number 1 Region: 1133-1432
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.88e-66
Family Tandem AAA-ATPase domain 0.0000382
Further Details:      
 
Domain Number 2 Region: 859-1131
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.21e-59
Family Tandem AAA-ATPase domain 0.0000337
Further Details:      
 
Domain Number 3 Region: 2406-2478
Classification Level Classification E-value
Superfamily BRK domain-like 0.00000000000000654
Family BRK domain-like 0.00019
Further Details:      
 
Domain Number 4 Region: 737-803
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000156
Family Chromo domain 0.026
Further Details:      
 
Domain Number 5 Region: 810-874
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000348
Family Chromo domain 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000019591
Domain Number - Region: 2091-2100
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000167
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 2366-2404
Classification Level Classification E-value
Superfamily BRK domain-like 0.0131
Family BRK domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019591   Gene: ENSONIG00000015569   Transcript: ENSONIT00000019608
Sequence length 2585
Comment pep:known_by_projection scaffold:Orenil1.0:GL831380.1:393560:412043:1 gene:ENSONIG00000015569 transcript:ENSONIT00000019608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPIMDLFEDTPLFNLDALQDDSFSQGSSDPVEEAFKLALGQVDPTPESEPAPELASNT
SLCVPVEAPAVPDPAPVQVPTQQPVQVATPQTISIAVAPPMTPAPGPAPTPTDTVNQIQA
QTTIPIASNASGATSSTVLLSSPLTVSSSPSTTTATTQQLTQITHQLTPQQLAAITQQAG
GKIVILKGPQGQAQVLQTVSGATGQTGGKVIRVVSGTPLKPGMSILQGGTVLNQQVQQTQ
GQPVQVQIPATAQITQGQVQPQAAQIQVQAQGQVQLQNQAAQIQVQPQAAQIQVQAQGQV
QLQPAMQAQTQGGEAKRITLVLQQPSQAGSATQAGQAVAAQQQVTQVQQVQTAQGGQPQQ
TQAPTKLVLGQLPGGKLVLQGSQLAALTQARAAGQAGGQPKVLTIQLQVQQQPNQQGGVK
YQLVSGAGNTGGPQVLQISQGQGGQRVAVPLKMLLQPQTSAASSTGGTVSVVKVINTSAA
GPSSTTTTPSQAIRITKAPGEPASVRRVEILCKQEKANRIVAEAIARAKARGEKNLPRVL
NQDELPATQSSPEMGGTVTVVSSAKKKTSSGGSKKKSPVSGGTAPKTAGGPDKKGKVKAP
GGTTIVAGGTVIPSAANKSKSKAKANTITLVGAKKRKRNASSDHSDGELSPASPAALEDD
MITKRRSNRVVKRKKYTEDLDIKITDDEDEQEDVDVTTTAAAVASISSGAPVQLKQEVEL
DGDGLPSMQFFVENPSEEDAAIVDKILSLRLTKKEVSPGQYTNIEEFFVKYKNYSYLHCE
WATLEQLEKDKRIHQKIKRFKTKQAQMRHLFQEDEEPFNPDYVEVDRILDVSHSVDKDNG
EPVIYYLVKWCSLPYEDATWELKEDVDEGKVEEFGKIQNRQPRLKRAARPPASSWKKLEE
TREYKNGNTLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIALLSEVYAAGVQGP
FLVIAPLSTITNWEREFSTWTNMNAIVYHGSLASRQMIQQYEMYCKDDKEHLIPGAYKFD
ALITTFEMVLSDCPELREIAWRCVIIDEAHRLKNRNCKLLDSLKMLDLEHKVLLTGTPLQ
NTVEELFSLLHFLEPAQFPSETEFLRDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNL
APKQETIIEVELTDIQKKYYRAILERNFSFLSLGASSNSNVPNLLNTMMELRKCCNHPYL
INGAEEKIVAELREVYDPLAPDFHLQALIRSAGKLVLLDKLLPRLKAGGHKVLIFSQMVR
CLDILEDYLINKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTA
ADTCVIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMLDKASLKLGLDRA
VLQSMSGNKDSNVNGIQQFSKKEIEDLLRKGAYAAIMDENDEGSRFCEEDIDQILQRRAT
TITIESEGKGSTFSKASFVASENRTDIALDDPEFWQKWAKKADIDMDTINRKNTLVIDTP
RVRKQTRQFSSLRGEGGDLSDLDSDEEYPPSNSRHSRASRRSDRHSGGGYGRTDCFRVEK
HLLVYGWGRWRDILSHARCKRRLSERDVETICRVILVFCLLHYRGDENIKSFIWELITPP
ENGREPQTLLNHSGLSIPVPRGRKGKRVKAQSTFDVQKVEWIRKYNPDTLLLDDSYRKHL
KHQCNKVLLRVRMLYYLKQEVIGEHSDSVLKGADIRDVDIWMPEMEQQEVPAGWWDSDAD
RSLLAGVFKHGYEMYTTMRADPCLCFLERVGRPDDKAIDAEQHTGDAELGDEGDYDKYSE
DPEFKPASRHTKDLFEEPESMNVDEEISVEDKAPPPVIIENSASHSGVCEWPSSSSLTAR
LRRLITAYQRSYRQEQLKIEAEAKGDRRRRRCEQASKLKEIARQERQQRWTRREECDFYR
VVSTFGVEKIKKEPGLPEGGEPEFDWTRFRTFARLDKKTDESLSRYFRSFVAMCRRVCHL
RPGREDPAEVTQTVAPITEERASRTLYRISLLRRLRERVLPHPCLEERLALAPPTSELPA
WWNIREHDRQLMLGASLHGVSRTELSIFADPQFTFSQAREEFIQNQQAPPPPPPPPPPPP
PQAPPIMTLSQPKTEEHMLGVKQEGTDENIGLLAGEIGAGLQSTPLSHHDGKMRGQGWSF
KRSKVRAEKTEGGRKGEGASDSDSDSDSGSSSSDRSSSSDDSGESEAEVEGGMKVCDVDE
DNSLLSMTMSQDGIPPPDPLRVDWPKDRVLINRLDSLCTLVLTGQWPSGRRYVSEAQLNP
NSELVGDEMAYTRVMRKPPIMPAVPGADGEDGEFTVKLLKEEGLKLTFSKQALMPNGSGG
EASGRKKRKEQEFSDMDGLHDPLERMPRRRDPPTWLKENPDYEVEGDMLELLVNRSKRKR
RRRADKAITGSEKVKLINMRTGKKVGAAFCPMLQDLREYLEENPDNAVAPEWSETVRNSG
FLPETLFHRLLTEHSEIPKKSRRRHHHHHHHHHHHHHHHTPEPTPEDPNLDGVEEETLVS
DGAYMMDEEDLESSHHFLTSPDFDVKMEGGDSLSQGDYDSSDQEALLDDVIIAQKDSDSS
SSSED
Download sequence
Identical sequences I3KEP6
ENSONIP00000019591 ENSONIP00000019591 XP_013120955.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]