SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019697 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019697
Domain Number 1 Region: 21-771
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.63e-258
Family Motor proteins 0.000000000283
Further Details:      
 
Domain Number 2 Region: 1668-1753
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000353
Family SH3-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019697   Gene: ENSONIG00000015652   Transcript: ENSONIT00000019714
Sequence length 1798
Comment pep:known_by_projection scaffold:Orenil1.0:GL831298.1:238389:277824:-1 gene:ENSONIG00000015652 transcript:ENSONIT00000019714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGREGFTSWDSAKPKHWFDKMYAIRSLPTMVQREQREENGVEDMTQLDDMHEGAVLLNIR
KRFERELIYTYIGSILVSVNPYKMQNIYGTDMVLMYKGCALGENPPHLFAIANAAHSQMM
DAKKNQVIIISGESGSGKTESTKLILRYLAAVLHKTNLAQQILEAAPLLESFGNAKTVRN
DNSSRFGKYIEVFMENGMISGAITSQYLLEKSRIVFQAKNERNYHIFYEMLAGLPSQQKQ
AFYLQEAETYYYLNQGGDCGIKGKNDAEDFLRLLSAMEILHFTADDQSSIFRVLSSILHL
GNVYFQRHEVDGQEVASVVSTQEIRVVAELLQISPEGLQKAVTYKVTETMRDKIYTPLSV
ESAIDARDAVAKILYSLLFRWLTERINGQVYPRQHTLSISILDIYGFEDLVLNSFEQICI
NYANEYLQFFFNRIVFREEQEEYSREQIPWQDIPFNDNQPCIDLIAAKPHGILRILDDQS
GFPQATDNTFLQKCHYHHGSNPLYMKPKMPVPEFTIKHFAGRVTYQVYKFLDKNYDQVRQ
DVLDLFIQSKNKMVSNLFLVHAEATGQQRGHIRKSSTVTRKYQAPTVSSKFQQSLLELVE
KMERCNPYFVRCIKPNNMKQPGVFEDELVNSQLLHSGVMETIRIRKEGYPVRMPFYVFLF
RYKSLAGIQTLPVANGENCVMLLGKLCPLRPGAYHVGVTKLFLKEDIYQLLECKRERSRH
LAALTLQRYTRMFFVRKRYVDFRNKISRFQAHCLGFLVRKRYVKMRESLVRFRSLVHMYV
NRKQYIKELTKREVVNVTHLVIPAELGALLQTAGVHRELHSDCLALLQAPHIQDDAELTL
PLDINNYPFFRYVQIHFREPKFGMLMAPLESPLTRVEDDLRGEALELFNMVLRFMGDPHL
NGAQENMFGNYIVQRGLSSPGLRDEILAQVVNQVWRNINSENAERGWLLLLACVCCFAPS
AKMDKYLLKFVSDHAPAGCQVLLQHRLIQANQKMQLGSGSDPETARTYPLSLLEWTANRK
KANMVLHVHCLDGGSFLCPVHSWTSGEDLAGNILRHRGVSDWWRGSSILMKEQGQWVELA
GHDYVMDLIADMELPMDFPKQKSYFIISTDNPAKVRANASLALFGSGFDSDEELPSSLPL
SSSRPAYSLPDSDGYYSHSHDGNVSYINAAAPWQQLMEELESETLSEGQPQRGMDRYLDS
LFDPVLSDSSTDMEKSGSLSERMKGGGGIGITGEGREEGESRPASSRPYPPGIHPGGSEQ
AVLTQQQQAIINQQAIILAQQMTMQAIAIQQQMLSSFPPAAPAPQSPPSYYHAHSQQRSR
TPSPTKESEESPHKPSAAAVQRKTSPSRGPPPEDVVRSTVSNTEHLDPSHDIKDIVKQHQ
PAGTASSSGSPTQRRSDGKLFGKKPDPHDEAMEILKDQMAKKASFAQSKEDRGHKTSQKA
KPRPQGPSSSNINPAPPPVSRELPVEEEIIQTQLHSRTSDEYYTYSNVPWKLYMRKEVFY
PKENLNNPLILDLIFRQVVHDTFSEACIRITQEERQRMKDLLAENKVDQVSGTYNENVKK
KVATMARDEWEIYFSRLFPASGSVGTGVQVLSVSHKGIKLLKMVKSSSSASDYFRVLRPY
SYSDILFVSIPSKNMLEFNLTNEKLILFSAKAPHVKHMIDYFLTELKKDSEYVVAVRNYI
TEDRTQLNFHKGDIIRLQHMDGLEAGKRYGCIVRKKVMLLEELKRNTAEFGWRFGAVYGK
SGVFPSEYIRPVAAPDFLVLPPERVEPRDRQGRVAASAAVAVAMGSAVAAHELDLSTE
Download sequence
Identical sequences I3KF02
ENSONIP00000019697 ENSONIP00000019697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]