SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019705 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019705
Domain Number 1 Region: 366-569
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-55
Family Nucleotide and nucleoside kinases 0.00016
Further Details:      
 
Domain Number 2 Region: 195-304
Classification Level Classification E-value
Superfamily SH3-domain 1.74e-24
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 106-211
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-21
Family PDZ domain 0.0021
Further Details:      
 
Domain Number 4 Region: 63-113
Classification Level Classification E-value
Superfamily L27 domain 0.000000000447
Family L27 domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019705   Gene: ENSONIG00000015657   Transcript: ENSONIT00000019722
Sequence length 571
Comment pep:known_by_projection scaffold:Orenil1.0:GL831347.1:41581:52442:1 gene:ENSONIG00000015657 transcript:ENSONIT00000019722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGVSEVLSSVVKDVDQAVSRNINGAQLLHELLSAPWLCALLKIYECLLKFQRLTPSPVLP
YAAGLSHEVMTAILKAQNPSAPARELCSLLSSPHIQALLSSHDSVAQSDYEPVLPPLPDE
IPEDEEAMRIVCLVKNNQPLGATIRKDEATGDIYIARVIHGGLADRSALLHPGDLLVEVN
GNPVVGLEPEQVIHILANSQGTILFKVIPNPSQASNSQTLVCMRAMVDYCPLQDSSIPCP
DAGMAFSRGDLLQVVDQSDGQWWQARKLPCATSCAGLIPSASMLKSKQREQWWCQPLQVH
TCIRPRTIIAELFVTWIFLTGFRRSFRVWKRTSYRKRRQSCTTCSPNTNALSTPYEEVVL
YQRPPQENHRLIILVGASGVGVNELRKRLIKLNPSTFQGPVPHTTRSIRAGEQNDREYHF
VTKELFEYMVCNHRFVEYGESKGQLYGISTDAIDEVLKRGRMCIIDAEPHSIQLLRTKKF
KPYVIFIKPPSPDRLRQTRRDARIITNYAINRVFSEEDFVELEETSKLIEAKYKQFFDSV
LVNDDLQDACIELCSIIQQAQDEPQWIPVSW
Download sequence
Identical sequences I3KF10
ENSONIP00000019705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]