SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019808 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019808
Domain Number 1 Region: 805-845,896-921,967-1146
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.46e-54
Family Tandem AAA-ATPase domain 0.00022
Further Details:      
 
Domain Number 2 Region: 523-797
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-52
Family Tandem AAA-ATPase domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019808   Gene: ENSONIG00000015742   Transcript: ENSONIT00000019825
Sequence length 1147
Comment pep:known_by_projection scaffold:Orenil1.0:GL831347.1:906701:918954:-1 gene:ENSONIG00000015742 transcript:ENSONIT00000019825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVVCSIHGGVCMLKTGLKDGPNKGKSFYVCVDKQGCDFSQQTSISPSHCLHHEDSMVE
LQALSYSQPQQGYRLFYRCAVGKKAGQRWCGNVPWTAPETEKRSPLSDTQLQPSCLPPVR
NPFKAPSQADKDSEWRKLQNNRHEEKEASHKAEGRASYQKENERQQGAGVEEKADDKHRS
SDTYRGKQLPLGMKLKKRVSNEENNSPKENSVEKRTEKIQDTPEQNRIKQGEEEKGISSS
SVKTVHSESSNKHQLKTINQTAPVSHRNLTQQPSDAETSQVKETKQILEKSSCTHASRDS
DSSRSPIPDKPTQSESSQPNSPENNDDDDDVVLVSVKPAPQKTPPVSTVQKTLTNFPGFQ
PASNIKKPVENPKGLQNLLTVQLQQKKATLSSVNLEALPDKGDRLRTQVKELEEALESLS
LTAASQPESEKACSSTDSGFSTTQMNPFSRQGGTILLPAPPAPALHHHQASGGSLGLQLS
QGYSQMYGAYPQAQTFYGGRMTDDRLLAVKNATCEAIDHLHKSLESCPDAEAEAPDPKGI
KVPLLPHQRRALAWLLWRETQSPCGGILADDMGLGKTLTMISLILAMKMKAKKDKEEMEE
KKKDSWLSKTDCSLVLSKGTLIICPASLVHHWKKEIERHVKTGKLTVYLYHGPNRERSAR
VLANYDVVVTTYSLVSKEIPVQKEEADKPNPDKDDVRPGSAPLLRVSWARIILDEAHSIK
NPKVQTSMAVCQLRAGARWAVTGTPIQNNLLDMYSLLKFLRCSPFDEYKLWKAQVDNGSK
RGRERLNILTRTLLLRRTKDQLDAKGKPLVSLPDRTSEVHRLKLSEDEQAVYDVLFAQSR
STLQSYLKQHEGNDVKKGSTSSSNPFEKVAQEFGLSQADPALSSSQQAKQVSSTVHILSL
LLRLRQCCCHLSLLKKTLDSSELQGDGIVLSLEEQLNALSLSSSPSPSGPDPKDTVALNG
TRFPSRLFEGTSKSTKISAIISELKAIRENSNDHKSVIVSQWTSMLQIVAVHLQLMGLTY
SVIDGTVNPKRRMDLVEEFNTNPKGPQVMLVSLCAGGVGLNLIGGNHLFLIDMHWNPALE
DQACDRIYRVGQCKDVTIHRFVCENTVEEKISTLQAKKKELAQNVLSGTGNTLSKLSLAD
LKIIFGV
Download sequence
Identical sequences I3KFB3
XP_003456658.2.78416 ENSONIP00000019808 ENSONIP00000019808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]