SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019824 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019824
Domain Number 1 Region: 709-829
Classification Level Classification E-value
Superfamily Bromodomain 5.89e-30
Family Bromodomain 0.00095
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000019824
Domain Number - Region: 64-121
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0481
Family Bacterial exopeptidase dimerisation domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019824   Gene: ENSONIG00000015750   Transcript: ENSONIT00000019841
Sequence length 895
Comment pep:known_by_projection scaffold:Orenil1.0:GL831239.1:88020:102453:1 gene:ENSONIG00000015750 transcript:ENSONIT00000019841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGIGKHKILNVGPTEPWSVREKLCLASSVMRSGDQNWVSVSRAIKPFAEPGRPPDWFS
QKHCASQYSELLEATEAPKRKRGEKGEVVETIEDVIVRRLTAERIEELKKLIRDTQEQYR
KLKKEVDLIQMGHMDSQLKELWGEITLKKKQDEEEAEQKRKATEMAYQARQAVKNTPKRL
PSVTVRSPLGASPPTQDSQTDSSAPTPPMDTGAGVSEDTTTTHSVAQGVGVFLPAADPPG
PGPKDGGLAALVDDSPQKRLLSQKATPPPSPLLSELLKKGNLISASPRLVRVLAKPLSFD
TYSNTNIQRMELGVNPVAEGDSTGSLTNGVQTATAATALPPGHDIITDYTGPAFFTACLV
AVLGNNGIHGAPKNVLILKKQKLQSMFKVTLNVFVSGGTLLHVSPPFFPFVFLQSISKVV
SLFNKMHYEFFLAVYISEGEAEAAVKAELGEDTGLVEEDLVAVSYIGDELDLETVGDIIA
IIEEKIDDDPVALDAAAVEAALSLCEEAVSEGHTLPGPWETQELKASEPTPTIQESAPPQ
TPQDMAATLAPTPASQETQNQPDTKREEPLKGNYEGPEVTGSDVTSSVTSDDGVAASEVA
EEGPVVKEVTEATVKSEGEEWSQPEPNPPCLDSEDSSVSGKESKEVKEEEAGSEGDPEEA
MELKDECGEGEGPYLSEVDRAASESEDGYGPPSQRYTADSLASSPASSSQLSTCGEDQEA
VQAQKIWKKAIMLVWRAAANHRYASVFLQPVSDDIAPGYHSIVHSRPMDLSAIKKNIESG
VIRTTAEFQRDIMLMFQNAVMYNSSDHDVYHMALEMQRDVLEHVQQFLATQLIMQTSESA
ISAKSLRGREGNRKPGEPAEKDSVPMASPAFLLSLFDGGTRGRRSAMEADLKMKK
Download sequence
Identical sequences I3KFC9
ENSONIP00000019824 ENSONIP00000019824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]