SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019924 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019924
Domain Number 1 Region: 80-266
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.81e-55
Family G proteins 0.000000681
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019924   Gene: ENSONIG00000015828   Transcript: ENSONIT00000019941
Sequence length 279
Comment pep:known_by_projection scaffold:Orenil1.0:GL831239.1:1048237:1062357:-1 gene:ENSONIG00000015828 transcript:ENSONIT00000019941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNDSPEEETRAPGGGGGGCGRGIGRKHRADDNVTILTSSMDLHRASRSRASSSNNDAAP
SITSSVDLSTSSLELSIQTRIFKIIVIGDSNVGKTCLTFRFTGGSFPDKTEATIGVDFRE
KVVEIEGETIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMASFRNLQTWIEEC
NGHRVSASVPRVLVGNKCDLVDQIQVPSNMALKFADAHNMLLFETSAKDPRESQNVNSIF
MSLACRLKAQKSLLYRDVEREDGRVRLTQETETKSNCPC
Download sequence
Identical sequences I3KFM9
ENSONIP00000019924 ENSONIP00000019924 XP_003451840.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]