SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019925 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019925
Domain Number 1 Region: 44-141
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-24
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 180-229
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000209
Family SOCS box-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019925   Gene: ENSONIG00000015829   Transcript: ENSONIT00000019942
Sequence length 230
Comment pep:known_by_projection scaffold:Orenil1.0:GL831148.1:225962:226977:1 gene:ENSONIG00000015829 transcript:ENSONIT00000019942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVTFAGHNPVAMSSVTPPEGRVQGSNFTPHHFKPFSSHEHYQQVMRALHKLQQSGFYW
GAVGGREASSLLRSQPPGTFLVRDSSDHHHFFTLSVQTTKGTKNLRIHSEGGGFFLQPDP
QNTQELPQFDCVLKLIAHYMRKGQDTEGTKEGASGENPGETKTKAHNVYLIHTGGEKIPL
ELRRPLSTCLSSLQHMCRRTLNNQGLGASERTEQLPDTLRDYLEEYDAPI
Download sequence
Identical sequences I3KFN0
XP_003441788.2.78416 XP_005471521.1.78416 XP_005471522.1.78416 XP_013124996.1.78416 XP_019217984.1.78416 ENSONIP00000019925 ENSONIP00000019925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]