SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019958 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019958
Domain Number 1 Region: 856-1025
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.1e-51
Family SPRY domain 0.00041
Further Details:      
 
Domain Number 2 Region: 593-847
Classification Level Classification E-value
Superfamily RNI-like 1.83e-38
Family 28-residue LRR 0.00048
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000019958
Domain Number - Region: 174-259,289-341
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000734
Family G proteins 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019958   Gene: ENSONIG00000015852   Transcript: ENSONIT00000019975
Sequence length 1031
Comment pep:novel scaffold:Orenil1.0:GL831148.1:452945:460582:1 gene:ENSONIG00000015852 transcript:ENSONIT00000019975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQSIVSDKTDDFSEVPFIQAAVHNFQPNYTAQSGGNVVAPSIIGSNVGNININIFSATQ
ECKEDLNNDHTDSCGALPPEIDKVAECQQNLKATLRRKFSHILEGLATETNKISLNNIYT
ELYVTEGGSGEVNKEHEVRQIETTPRIHVGQEKSIHCNHLFAPLPERGCDIRTVVTRGVA
GIGKTVLTNKFTLDWAEERANKNLEFVFPLSFRELNLMKKKNFSLVELLVVLFPEIKDIE
IFTNVKKNMLFILDGLDESRLSLDFNKCEILSDVTQTTTIAVLMTNLIRGRLLPMALVWI
TSRPVASSQIPANCVDLVTEVRGFNNLQKDEYFRRKISDENLANRVIAHVKTCRSLHIMC
HIPIFCWMAATVFEKNMATKESKDTPKTLTQMYIHFLSLCEEAMKKRLTGRRESNADCVR
ANLLALGKLAFQELEKGHLIFNESDLKLNGIDTEQASMFSGVYTQIFHEEMTVCKEKMFC
FVHLSVQEFFAALYVFLTFHNDNVNVLVKLSASRRFLSRSSELILYKEAVEKALRSEKGD
FDMFLRFLLGLSLESNQTLLKHLMINNRTQQKTRTEIVKHIKEKIRSSPSPDRCLNLFHC
LNELNDHSLVEEIQSYLSSGSLNRANLSPAQWATLVFVLLTSEEEQSVFELGNYTRSEEG
LLRLLPVVKTAQVANLNACNLTLACCENLANAISSSQLRELDLSNNNLTDAGLMKLSSGL
RNSKVETLRLKSCNLTEHSSNDLASFVSSASCLLKLLDLSDNEFHDLGVKRFSDGLRSSD
CKLETLNLSLCGVGEEGCIFLASALNSCHLRELDMSYNHPGNSGLNLLTALKEDPQCTLV
KLSIDQCGEFRIQPSPKKYTIKLTLDPNTAHKDLSLSEENRKATRWTKQPYPDHPERFDY
WTQVLCREGLKGRYYWETEWTGRVFIGVAYRRISRKGETDDCWLGRNNSSWGLNCNKDGY
KALHKGTSIPITTKPNSNKVGVFLDWSAGTLSFYMLSCDSLKLLHTFHTTFDKPVYPGFH
LAWVDSKVYLC
Download sequence
Identical sequences I3KFR3
ENSONIP00000019958 XP_019218008.1.78416 ENSONIP00000019958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]