SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020165 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020165
Domain Number 1 Region: 5-217
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4e-66
Family D-ribulose-5-phosphate 3-epimerase 0.00000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020165   Gene: ENSONIG00000016008   Transcript: ENSONIT00000020182
Sequence length 228
Comment pep:known_by_projection scaffold:Orenil1.0:GL831311.1:662715:666260:1 gene:ENSONIG00000016008 transcript:ENSONIT00000020182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYSAKIGPSILSSDLSCLGSECVRMMECGADYLHLDVMDGHFVPNITFGHPMVECLRKS
VGQDPFFDMHMMVSRPEQWVKPMAAAGANQYTFHLEATTNPGNLIKEIRESGMKVGLAIK
PGTTVEELAPWANEIDMALVMTVEPGFGGQKFMEDMMPKVSWLRSQFPSLDIEVDGGVGP
DSIHKCAEAGANMIVSGSAVIGSDDPRSVIALLRTVVAEAIQKRSLDR
Download sequence
Identical sequences I3KGC0
ENSONIP00000020165 ENSONIP00000020165 XP_003455506.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]