SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020461 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020461
Domain Number 1 Region: 321-604
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.81e-74
Family Tandem AAA-ATPase domain 0.00000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020461   Gene: ENSONIG00000016252   Transcript: ENSONIT00000020479
Sequence length 710
Comment pep:known_by_projection scaffold:Orenil1.0:GL831210.1:2046361:2059456:1 gene:ENSONIG00000016252 transcript:ENSONIT00000020479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHVVVDNPHGLDQQLAALDLNSADGQGGGTGRRYIPPHLRNKDAPKNANKDSPGWDSGR
TNGFVNGYHDNRTNGGFGGRGPPRNDRGGRGAYRGNRGGGSFNQPLQNAGFGNYENKEGG
WGGPPRDAAYNSFGGRSDRSKSAFFNDRGAGSRGRYERGGFAGGGSSRWAEESRDDDWSK
PTAPNERLEHELFSGSNTGINFEKYDDIPVEATGSSCPPHIESFHDVDMGEIIMGNINLS
RYTRPTPVQKYAIPIIKSKRDLMACAQTGSGKTAAFLLPVLSQIYTEGPGDALQAAKNSG
QKHVLSSQENGRYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIG
QQIRDLERGCHLLVATPGRLVDMMERGKIGLDYCHYLVVDEADRMLDMGFEPQIRRIVEQ
DTMPPKGIRRTMMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEETDK
RSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQF
RSGRCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFND
KNSNITKDLLDILVEAKQEVPSWLESLAYEHQHKSNNRGRSKRFSGGFGARDYRQTSGSG
SFSNNRSGRSAGGHGGNRGFGGGGFGGNFYGSDSYGGNYSHSGSVDWWGN
Download sequence
Identical sequences I3KH66
ENSONIP00000020461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]