SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020561 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020561
Domain Number 1 Region: 607-690
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 5.23e-37
Family Kix domain of CBP (creb binding protein) 0.0000047
Further Details:      
 
Domain Number 2 Region: 960-1086
Classification Level Classification E-value
Superfamily Bromodomain 8.11e-35
Family Bromodomain 0.000000633
Further Details:      
 
Domain Number 3 Region: 357-451
Classification Level Classification E-value
Superfamily TAZ domain 2.49e-28
Family TAZ domain 0.00000142
Further Details:      
 
Domain Number 4 Region: 1996-2052
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 1.37e-25
Family Nuclear receptor coactivator interlocking domain 0.000092
Further Details:      
 
Domain Number 5 Region: 1653-1737
Classification Level Classification E-value
Superfamily TAZ domain 6.28e-24
Family TAZ domain 0.00000184
Further Details:      
 
Domain Number 6 Region: 1589-1636
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000212
Family ZZ domain 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000020561
Domain Number - Region: 1166-1207
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00021
Family PHD domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020561   Gene: ENSONIG00000016330   Transcript: ENSONIT00000020579
Sequence length 2384
Comment pep:known_by_projection scaffold:Orenil1.0:GL831216.1:1907046:1946908:-1 gene:ENSONIG00000016330 transcript:ENSONIT00000020579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENLLDAGPPLSKRPKLNSPALSTSDGQDLGSLSWDDLENDLPDELIPNGGDISLMGGM
PSNGGAAPGAGGPGGTQSGLGGGSASVVPDAAAKHKQLSELLRAGSTSNIGTASPQPGSM
GPQLGAPLGKSPLGQGSPNNHPSPQAQKAGTPTGVAGQNNNNNTATMGLNTTGFSPAMIN
NNQGHTGLLNQGGQPQPGQVMNGGLVPGAGRGRGAGVTGMQYQGQTMQGTATGQGGSGSA
LAETLTQGGQQMGAHTTLSTAQQAGNMNKMGLGSNGPFGAQSYGQGATGPGQQLNPQQQL
QNKSALANSLPPFPNELKGAAVTSVPNMQLQQQPPQQQAAMLPLAGGGGVAVPSAGPTAD
PEKRKLIQQQLVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKSCQVA
HCASSRQIISHWKNCTRHDCPVCLPLKNASDKRTQQPMLSSPNTGLQNSMSSVGVGQPST
PTISTSAPIDPSSMQRAYAALGLPYSSQATGQAPTQQAPGAGQTAGAPNTQAQQQLPQQM
RPISALGNQMALGNAAMGVPTSEQTNLHTDSLPNTLNTNNQLLSDGSAVGSMSSLPTAAP
VSATGSRKAWHEHVTQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYE
SANSRDEYYHFLAEKIYKIQKELEEKRRSRLQKQIINQAPMAAQGTQQPVLAQPNALGPR
PQNGPVPLPNMPNQIMSRMQVSQGINQFNHMTLPNPQMSQAPMGARAASPMNHPQQMNIN
SVPAMGMSPSRMPQAQAMIAGHSGGNIVGQTANQGQFLPQNQFPPGSAPVAATGAMNVTV
VPGMGQPQAQAAVTQLSQPGASLDNRVPTPASAASADLHSQHVGADLPTQEVKTETHHDQ
QEFEASGGKTEPKMETEDESAPMLAKKEEPEEKPEPMEVEEKKPEIKTEPKEEEEGGVNS
TTTSSPSQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPMLLGIPDYFDIVKN
PIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFESEIDP
VMQGLGYCCGRKYEFSPQTLCCYGKQLCTIPTGGTYYSYQNRYHFCEKCFNEIQGDSVTL
GDDPAQPQTRISKDQFERKKNDVLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFICDNC
LKKSGKTRKENKFSARRLQATRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEI
KPGMKARFVDTGEMPEAFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECPFPNTRRVYI
SYLDSIHFFRPRILRTAVYHEILIGYLEYVKKLGYAQAHIWACPPSEGDDYIFHCHPPDQ
KIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEE
SIKELEQEEEERKKEENTAASETPEGTPSDSKNAKKKNNKKTNKNKSSVSRANKKKPGMP
NVANDLSQKLYATMEKHKEVFFVIHLHSGPMVNTLPPIVDPDPLLSCDLMDGRDAFLTLA
RDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDFDLCIN
CYNTKGHEHQMVKWGLGLDDDNNSQSGEASKSPQESRRLSIQRCIQSLVHACQCRNANCS
LPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLR
QQQLQHRLQQAQLMRRRMATMQCRTMPLPSPPPSAAPSTPTPTSHTQPNTPQTPQQPLSN
QPQTPNSAGVMSPTFPNAARAAQAQAPVSQGKPGPQASPLHQQQSPLPQPPQPSQQLSQQ
PPPIAAVKMAQRIEMMAQAQQSQRNYRVNVNGLPMNPQQPQQRMTTPMQPAMQMVPGPRG
PPVMQPGMATGQWGGASGPIQPGQTQQPGLVPGQSPQQAMTMQRAMMPPGQQPQQSQRML
IPQQPGARPQTPQRAGAIPPNALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQR
TAKYHANQPQQQQQQQQAGQQQQPGMPAMQNMAMSGGAVQRTGMPPQQPQQPQVQSMAAL
GTQGQLSTAHNANPQIQEIFRRQLLLQQQQQQQQQQQQQQQQQQQQQQGVLPQGHPGQFA
AQSQGTTPTYSQLRMQQQQQQQQQMQMQAGAPGGPMGQLPPMAQMAQSGMGMDSTQNLLH
QRLLQQQQQLPQQQAVLKQQMGSPGQPSPMSPQTHLLAGQPQGGAHLPGQPTLANALSNQ
VRSPAPVQSPCPPSQQQPPHSSPSPQVQNQPQPSPQHPPPPHSGSPHTGLGGPLQSMEQG
HLGTPEQSAMLPQLNTPNRGGLSNDLGMVGDATGDTLEKFVEGL
Download sequence
Identical sequences I3KHG6
ENSONIP00000020561 XP_005454858.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]