SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020562 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020562
Domain Number 1 Region: 578-661
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 5.49e-37
Family Kix domain of CBP (creb binding protein) 0.0000047
Further Details:      
 
Domain Number 2 Region: 1065-1191
Classification Level Classification E-value
Superfamily Bromodomain 8.5e-35
Family Bromodomain 0.000000633
Further Details:      
 
Domain Number 3 Region: 326-420
Classification Level Classification E-value
Superfamily TAZ domain 2.62e-28
Family TAZ domain 0.00000142
Further Details:      
 
Domain Number 4 Region: 2091-2147
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 1.45e-25
Family Nuclear receptor coactivator interlocking domain 0.000092
Further Details:      
 
Domain Number 5 Region: 1758-1842
Classification Level Classification E-value
Superfamily TAZ domain 6.54e-24
Family TAZ domain 0.00000184
Further Details:      
 
Domain Number 6 Region: 1694-1741
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000224
Family ZZ domain 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000020562
Domain Number - Region: 1271-1312
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000219
Family PHD domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020562   Gene: ENSONIG00000016330   Transcript: ENSONIT00000020580
Sequence length 2455
Comment pep:known_by_projection scaffold:Orenil1.0:GL831216.1:1910472:1946908:-1 gene:ENSONIG00000016330 transcript:ENSONIT00000020580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENLLDAGPPLSKRPKLNSPALSTSDGQDLGSLSWDDLENDLPDELIPNGGDISLMGLG
GGSASVVPDAAAKHKQLSELLRAGSTSNIGTASPQPGSMGPQLGAPLGKSPLGQGSPNNH
PSPQAQKAGTPTGVAGQNNNNNTATMGLNTTGFSPAMINNNQGHTGLLNQGGQPQPGQVM
NGGLVPGAGRGRGAGVTGMQYQGQTMQGTATGQGGSGSALAETLTQGGQQMGAHTTLSTA
QQAGNMNKMGLGSNGPFGAQSYGQGATGPGQQLNPQQQLQNKSALANSLPPFPNELKGAA
VTSVPNMAAMLPLAGGGGVAVPSAGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVR
ACALPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASD
KRTQQPMLSSPNTGLQNSMSSVGVGQPSTPTISTSAPIDPSSMQRAYAALGLPYSSQATG
QAPTQQAPGAGQTAGAPNTQAQQQLPQQMRPISALVTGNQMALGNAAMGVPTSEQTNLHT
DSLPNTLNTNNQLLSDGSAVGSMSSLPTAAPVSATGSRKAWHEHVTQDLRNHLVHKLVQA
IFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHFLAEKIYKIQKELEEKRRS
RLQKQIINQAPMAAQGTQQPVLAQPNALGPRPQIFPDGPVPLPNMPNQIMSRMQVSQGIN
QFNHMTLPNPQMSQAPMGARAASPMNHPQQMNINSVPAMGMSPSRMPQAQAMIAGHSGGN
IVGQTANQGQFLPQNQFPPGSAPVAATGAMNVTVVPGMGQPQAQAAVTQQQQQQQSANLP
MNALGPSLGPQLASSQTPLHSTPPPAASSASTAGGATNLPLPQPSSRSSTPTLPGPAPAP
AQGATPPCPTQSQPQTELPAAAQTQPPPQPPTTPVRLSPFACPPLLTPSSLPCKLPSLCL
LSQPGASLDNRVPTPASAASADLHSQHVGADLPTQEVKTETHHDQQEFEASGGKTEPKME
TEDESAPMLAKKEEPEEKPEPMEVEEKKPEIKTEPKEEEEGGVNSTTTSSPSQSRRKIFK
PEELRQALMPTLESLYRQDPESLPFRQPVDPMLLGIPDYFDIVKNPIDLSTIKRKLDTGQ
YQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFESEIDPVMQGLGYCCGRKYEF
SPQTLCCYGKQLCTIPTGGTYYSYQNRYHFCEKCFNEIQGDSVTLGDDPAQPQTRISKDQ
FERKKNDVLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFICDNCLKKSGKTRKENKFSA
RRLQATRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEIKPGMKARFVDTGEMP
EAFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECPFPNTRRVYISYLDSIHFFRPRILR
TAVYHEILIGYLEYVKKLGYAQAHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYRKM
LDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEESIKELEQEEEERKKE
ENTAASETPEGTPSDSKNAKKKNNKKTNKNKSSVSRANKKKPGMPNVANDLSQKLYATME
KHKEVFFVIHLHSGPMVNTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRCKW
STMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDFDLCINCYNTKGHEHQMVKWG
LGLDDDNNSQSGEASKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTK
GCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQLMR
RRMATMQCRTMPLPSPPPSAAPSTPTPTSHTQPNTPQTPQQPLSNQPQTPNSAGVMSPTF
PNAARAAQAQAPVSQGKPGPQASPLHQQQSPLPQPPQPSQQLSQQPPPIAAVKMAQRIEM
MAQAQQSQRNYRVNVNGLPMNPQQPQQRMTTPMQPAMQMVPGPRGPPVMQPGMATGQWGG
ASGPIQPGQSPQQAMTMQRAMMPPGQQPQQSQRMLIPQQPGARPQTPQRAGAIPPNALQD
LLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYHANQPQQQQQQQQAGQQQQPG
MPAMQNMAMSGGAVQRTGMPPQQPQQPQVQSMAALGTQGQLSTAHNANPQIQEIFRRQLL
VLPQGHPGQFAAQSQGTTPTYSQLRMQQQQQQQQQMQMQAGAPGGPMGQLPPMAQMAQSG
MGMDSTQNLLHQRLLQQQQQLPQQQAVLKQQMGSPGQPSPMSPQTHLLAGQPQGGAHLPG
QPTLANALSNQVRSPAPVQSPCPPSQQQPPHSSPSPQVQNQPQPSPQHPPPPHSGSPHTG
LGGPLQSMEQGHLGTPEQSAMLPQLNTPNRGGLSNDLGMVGDATGDTLEKFVEGL
Download sequence
Identical sequences I3KHG7
ENSONIP00000020562 ENSONIP00000020562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]