SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020659 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020659
Domain Number 1 Region: 471-760
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.98e-77
Family Extended AAA-ATPase domain 0.000000000344
Further Details:      
 
Domain Number 2 Region: 199-462
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.27e-65
Family Extended AAA-ATPase domain 0.00000000125
Further Details:      
 
Domain Number 3 Region: 106-196
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 3.6e-34
Family Cdc48 domain 2-like 0.00000359
Further Details:      
 
Domain Number 4 Region: 21-104
Classification Level Classification E-value
Superfamily ADC-like 1.08e-24
Family Cdc48 N-terminal domain-like 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020659   Gene: ENSONIG00000016404   Transcript: ENSONIT00000020677
Sequence length 803
Comment pep:known_by_projection scaffold:Orenil1.0:GL831216.1:2345762:2354255:-1 gene:ENSONIG00000016404 transcript:ENSONIT00000020677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLFGSPKGEDYSTAILKQKHRPNRLIVDEAVSEDSSIVSLSQVCVRELQLFRGDTVVLRG
RKRRQTVCIVLTDDTCGDERIRMNRVTRNNLRVRLGDVISIHACPDIKYGKKIHVLPIDD
TIEGLSGNLFDVFLKPYFLEAYRPVHKGDIFLVRGSMRAVEFKVVETDPSPHCIVAPDTV
IYCEGEPIKREDEEESLNDIGYDDIGGCRKQLAQIKEMVELPLRHPGLFKAIGVKPPRGI
LLYGPAGTGKTLVARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAENNAPAII
FIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSVDPALRRFG
RFDREIDIGIPDSTGRLEILQIHTKNMKLAQDVDLERIATETHGHVGADLAALCSEAALQ
AIRKKMTLIDLEDETIDADLLNSMAVTMDDFQWALSQSNPSALRETVAEVPQVNWEDIGG
LDEVKRELQELVQYPVEYPDKFLKFGMTPSRGVLFYGPPGCGKTLLAKAIANECQANFVS
IKGPEMLTMWFGESEANVRDVFDKARQAAPCILFFDELDSIAKSRGGGAGDAGGAADRVI
NQILTEMDGMSDKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDKPSRTAILKANL
RKSPVARDVDLEYLSGITDGFSGADLTEICQRACKLAIREAIEAEIKAERQRQNRPGIPM
DEDFDPVPEIRKDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGNFRFPSATGSQS
GSQGSGSGRPSLYRDEGDDDLYQ
Download sequence
Identical sequences I3KHR4
ENSONIP00000020659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]