SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020770 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020770
Domain Number 1 Region: 7-208
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.88e-26
Family G proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020770   Gene: ENSONIG00000016495   Transcript: ENSONIT00000020789
Sequence length 292
Comment pep:known_by_projection scaffold:Orenil1.0:GL831373.1:761289:765073:-1 gene:ENSONIG00000016495 transcript:ENSONIT00000020789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFPAGPDLRIVMIGKTGVGKSAVGNTILGVKHFRSCPFSKSVTKVCEKGVTQWGNRVV
SVVDTPGIVDTEISEEFIKREIVRCVEVSCPGPHVFLLVLQIGRFTKEEKNSVEALQELF
GPQANQYMIVLFTRGGDLGDTTIQEYVREAEPGLRRIIQRCGNRFHVFENTATDKKQVVE
LIKKIDYMVAGNGGTHYTDAMYKEVETRRVSDENEYMFILYVHSFKRVKNITTVAPLLCE
KKMNPKKKKLCSVEKQQIKKMYNIENKRKIIEIEIGPKIKERLNKFWDRLWK
Download sequence
Identical sequences I3KI25
ENSONIP00000020770 ENSONIP00000020770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]