SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020773 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020773
Domain Number 1 Region: 371-564
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.64e-22
Family G proteins 0.025
Further Details:      
 
Domain Number 2 Region: 75-259
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.07e-20
Family G proteins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020773   Gene: ENSONIG00000016497   Transcript: ENSONIT00000020792
Sequence length 572
Comment pep:known_by_projection scaffold:Orenil1.0:GL831373.1:805941:834565:-1 gene:ENSONIG00000016497 transcript:ENSONIT00000020792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTKTNEVRDQRRESAQTAGKPADVCAEPGKQPISEKSIKTIKQPQEQSVRSRPFVPLPR
LSEPRTVTGMPAKRTSNKVNLVLLGMSGTGKSASGNTILGKSVFFSRPSSQPVTRDCEIA
ETEINGKHVRVIDTPDMFDDDIEESVKNKYLKRCKELCESHPCVFVLVMHISRFTDGERN
ILKQLEKAFGRNVKEQSVILFTKGDDLHHAGKTLTDFLHSCQPDLKEMIQQLGNRCVLFE
NNRSGSAQVEKLLDTVIMVKSSGLRRGLNLNYFNSILFIQRQITTTVTSRQFICSSKGAT
VVSVPGIGELLTSTSTLENLVSRPIPDTGISACLGLEYMAGTCVTVGPSFHWKSSSSSSF
LRGAGSETSGEQIVTIGKTGVGKSAVGNTILGYERFRSCPLSASVTEFCQKAWVQWGNRV
VSVVDTPGILDTSKSDEFIKSEIVKCVEISSPGPHVFLLVIQIGRFTREEKNSVEALQEL
FGPEANKYMIVLFTRGGDLGSVTIEQYVRDAEPGLKRIIQSCGNRYHVFDNTSRDRKQVV
ELVKKIDKMVSVNKGTHYTDAMFQEVEEARKK
Download sequence
Identical sequences I3KI28
ENSONIP00000020773 ENSONIP00000020773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]