SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020848 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020848
Domain Number 1 Region: 658-770
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.29e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00027
Further Details:      
 
Domain Number 2 Region: 133-297
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.18e-30
Family G proteins 0.00000188
Further Details:      
 
Domain Number 3 Region: 389-462,598-645
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 4 Region: 790-880
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000107
Family Ankyrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020848   Gene: ENSONIG00000016553   Transcript: ENSONIT00000020867
Sequence length 907
Comment pep:known_by_projection scaffold:Orenil1.0:GL831365.1:557641:585640:1 gene:ENSONIG00000016553 transcript:ENSONIT00000020867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDIPRKDRLKSGSTSLPAPPTQAPKPARKGKSRTLDNSDLNSLSEDLGLAREAQQGQQG
QRGSAKDRKMLKFISGIFTKSSSGAAGSSSTAPPVYIQRDSSEEEDFLKTELFHLRMSPV
NIANSQEWTLSRSIPELRLGVLGSLKSGKSALVNKYITGSYSAVEKPDGGRYKKEVLVDG
QSHLLLIREEAGPPDAQFSSWADAVILVFSLENEASFQELYQLYSQLSAFRSDIPVIVVG
TQDKISSTNPRVIEDQRARQLCIDVRHSLFYETCATYGFNVDRVFSEAAQKIVAQKKQAA
LQACKSLPNSPSHSGGSTPGSASFPGQASNGPSIGYAYSLPSTPVVSHRELRVAQGDGGG
SVNARSLKSIPRRPSLFKNRDTDKRGGDAKGDLSNLRGVPIKQGILWKRSGSSLNKEWKK
KYVTLSNNGTLSYHSSSSDYTQNTHGKEIDLLRVTVKVPGKRPPRAVAPTGPSPAPPGAV
PGVNGLSKELPAADSTSTVPQLCPATLSVVADDRSGGLSPQDLLSLRQMSDALEATAGSF
GGKDPSQSSPMSDRKKNRRKKSMNQKGDAAVGQAEAKRKMWKLKSFGSLRNINKTEEENA
DFIIVSFTGQTWHFEASNMDERDSWVTAIESQILASLGSCESGRNKARRSSQSEAVALQA
IRNAKGNSQCVDCEAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPGELT
QVLAAIGNHMANSIWESCTQGRTKPTPSATREERESWIRAKYEQRAFVPPLVPASGTQLP
NDGVPVWLLSAVTDRDLPRLLLLLAHSTKEQINAPPAGSPSLPRTALHAACQLGDVVMTQ
LLIWYGIDVKAKDNQGQTAMMLATKKGSKSCIDILLQHGCPNETSPTAATPVLSRRSSTA
SLGRTSS
Download sequence
Identical sequences I3KIA3
ENSONIP00000020848 ENSONIP00000020848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]