SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021048 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021048
Domain Number 1 Region: 813-945
Classification Level Classification E-value
Superfamily Bromodomain 1.11e-22
Family Bromodomain 0.0011
Further Details:      
 
Domain Number 2 Region: 717-797
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.65e-17
Family PHD domain 0.0025
Further Details:      
 
Domain Number 3 Region: 147-210
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000421
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 3-75
Classification Level Classification E-value
Superfamily RING/U-box 0.000000169
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021048   Gene: ENSONIG00000016709   Transcript: ENSONIT00000021067
Sequence length 949
Comment pep:known_by_projection scaffold:Orenil1.0:GL831226.1:4599:16852:1 gene:ENSONIG00000016709 transcript:ENSONIT00000021067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMDTCPVCKLSFHNREPKLLPCLHSFCKRCLPAPFMSAEPRRDTQGQVDNSKPLVGIRCP
VCRQECWEMDVLDNFFVKDSAEVPSSTVEKTTQVCMSCDDNTEATGYCVECVEFLCVTCI
EAHQRVKFTRDHTIRQKEEMSPDAVSLSTQRPVFCDIHKQEPLKLFCETCDRLTCRDCQL
LKHKDHNYQFLEDAYRNHRQCLETMTQQLQEKRKAIEEVSSCINGGLQQVEENRKAVTNE
IKKSICNLIMEINRKGKILVNQLEALTKDHELGLKKQQEEVNSLGRHLDHVISFTKWATA
SHSGTALLYCKRLILYQIHYLMRAHCSPSTVPQSSVRFQCRSGFWATNVDLGSLVVERGP
SRPPITNHQTGPRAEAPTGALSLSTQQRQSTLAQLQMQHPRGPPPNPWSWHQNVRLPGPP
GPPPPTRPIHGGSSPSQGVPNMVQQGRRYGSSHPNPRSPTSSLLNNMSFPAAQVRQSLRD
LIHTSSFPPKPTDGSQGASRFPQPLTSGATTQMSLHQRCLPESSFLKRSEPGGSVPSITV
SVPKPNFPPILASATADKTTMLNHMADLKKKLPPFKGRGRQNSPMAKPSSSDRSMGTTSW
KQTAEPPSAPASKRRRRTSPGPVIVIKDEPEDDDEVRFKYKPPVDKRQSCQFKHTSLLGK
LSCFERSRIKILFQKSSVLNRESIQLTIRVQSSVGSSLPDSSTGAQSKPRQQQKGSPPAP
PPGSDSKDRRPQPQSQPESEKRAEPEEDPNEDWCAVCQNGGELLCCDKCPKVFHLACHIP
TLNESPSGEWFCSFCRDLVSPEMEYDCDSKDAPISEKFPPVDRRKCERLLLRLFCNDFST
DFQQPASPSETRRYKELIKTPMDLSIVKRKLESKSKDSESYVSPESFVEDVRLIFFNCAK
YYKLMPVMVYLIDISFILLQPTSEVGSAGLYLEDYFEEQLKLIYPDRVF
Download sequence
Identical sequences I3KIV3
ENSONIP00000021048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]