SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021134 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021134
Domain Number 1 Region: 21-178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.47e-49
Family G proteins 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021134   Gene: ENSONIG00000016776   Transcript: ENSONIT00000021153
Sequence length 181
Comment pep:known_by_projection scaffold:Orenil1.0:GL831428.1:102323:106270:-1 gene:ENSONIG00000016776 transcript:ENSONIT00000021153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKTSTEQSCNIYNAALICSKVKMVLLGSSGVGKSSLALRFSKDEFRSTSPTVGCAYLTQ
VVHLSNATLRFEIWDTAGQEKYHSVTPLYYRGAHVALLVYDITQRETFVRAQVWLKELEK
QYIPGSTVIWLVGNKGDLAHDRQVPLEEGESLASNKGLYFIETSALSGEQVNELLQSVGK
K
Download sequence
Identical sequences I3KJ39
ENSONIP00000021134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]