SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021182 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021182
Domain Number 1 Region: 33-149
Classification Level Classification E-value
Superfamily FKBP-like 5.11e-34
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 2 Region: 149-216
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000226
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021182   Gene: ENSONIG00000016810   Transcript: ENSONIT00000021201
Sequence length 223
Comment pep:known_by_projection scaffold:Orenil1.0:GL831428.1:502830:507299:-1 gene:ENSONIG00000016810 transcript:ENSONIT00000021201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKFRESKLTSYYLFVCFCLRFSLRPVWAAEEELDGEVKTEVLFKPEQCSQRSKRGDLIN
AHYDGYLAKDGSQFYCSRTDRDGQPQWFVLGVGQVIKGLDDGIMGMCPGEKRKLTIPSTL
AFGEKGKGPVPPNATVVFEVEVLSVSKGPRTMEAFGRMDLDKDKSLSKAEVKEYLKLEYE
KGGKPRDDPFYEKLIDDIFYKNDDDRDGVISAKEYNIYQHDEL
Download sequence
Identical sequences I3KJ87
ENSONIP00000021182 ENSONIP00000021182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]