SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021313 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021313
Domain Number 1 Region: 763-843
Classification Level Classification E-value
Superfamily E set domains 1.31e-20
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000955
Further Details:      
 
Domain Number 2 Region: 962-1069
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000342
Family Ankyrin repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 1393-1510
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000292
Family Motor proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021313   Gene: ENSONIG00000016902   Transcript: ENSONIT00000021332
Sequence length 1573
Comment pep:known_by_projection scaffold:Orenil1.0:GL831137.1:3885773:3917260:-1 gene:ENSONIG00000016902 transcript:ENSONIT00000021332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNPDIVLVHYLNVPAIEDCGKPCGPILCSINTDKKEWAKWTKEELIGQLKPMFHGIKWTC
SNGNSSSGFSVEQLVQQILDSHQTKPPPRTHNCLCTGTLGAGSSVHHKCNSAKHRIISPK
VDPRSGGYSSAHSEVQNNDVSEGKTEHSAHGGGKSSGGGTGGGSTREKRNGKVHKPVLLH
QNSTEVSSTNQVEVPDTTQNSPVSISSGLNSDPDMADSPVVTGMSHVASVMSGLSQSVFM
SEVPGDPVYSMSPTGGPNTHLMGADATSQGLVLSVTSDRHKFAFPSGGVGEPGTTTAGDS
LSMLSTAGVSEELVLSSSLDSGTIKIPETNMNFDPDCFLNNPKQGQTYGGSAMKTEGNSS
TSSSSGGGDNTYTFNSALVKNIKTEDTSFEQQLAKESGYQSSGAGSGQGSLSLTATGSLL
PSGGGLSPSTTLEQMDFSAIDAKQDYTSSTTTVSYGQAMSSPHMQHQNRSPSFFLQDASQ
TSQTQQKTHLMEHNSHDSGAYMGLQVVKTDSPGSNGHLHHHHQTHQTQAGSLQLLQYQGT
FPGLGTEHEETGATENGAENLLKAGDHIQGCGAGNGERGGTERYLQQASDGGGGGTGGTG
MVQGLYNAVGTHQGLGGAASNGGAGGTGMEISLDHFDISFGNQFSDLINDFISVDGSGTA
MSAGGTLYAHQLVTSHNSDNQTTAGGPPQQGQEDGGARGSGYSPSELCLQPCCSPQSLSG
GASAGGGTGETGSLSYMNVAEVVSAAVAQGALGMLQATGRLFMVTDYSPEWSYPEGGVKV
LITGPWQEATSNYSCLFDQISVPASLIQPGVLRCYCPAHDTGLVTLQVAVSNQIISNSVV
FEYKARALPSLPSSQHDWLSLDDNQFRMSILERLEQMERRMAEMASHQQTSGAGSGGAGG
GTGGGGGGGGGGGGGAGGGGNNSQSQCVSGQTQASSSFESRVVVVCEKMMSRACWAKSKH
LIHSKTFRGMTLLHLAAGQGYATLIQTLIKWRTKHADSIDLELEVDPLNVDHFSCTPLMW
ACALGHLEAAVVLYKWDRRALAIPDSLGRLPLSIARSRGHTKLAECLEQLQREEQQPPAP
LPPTTRMSFSPAPDAPTTDSWMVSWANTSVVAPSGKKGCPATTTTTPSTTSLNPDLRRPR
SEPSNYYSSEGQRDLPLAKKHKPNPELFQTRPDKAMSVPLSLEQQQLHKLSSSTKSLSSE
VLSSDKGLSTGGSTGTARWTSRESFSSSSNLGRKALGVSGGSSLGKEKLANRLRQREQLG
MLVMSESEMADSELLSYREDLENQDCLTQMDDLQVNMMTLAEHIIEATPERIKRENFTAA
DSVPLDTSGVSNTMNWLANYLGDVEQLPSIIHLRSLYNEPLTPSSNPSLSPGGSPLREGP
LERSTLPSPADWSEFINASNSKVERDLAQLTLSDPEQRELYEAARLVQTAFRKYKGRPLR
EQQEVAAAVIQRCYKKYKQYALYKKMTQAAILIQSKFRSYHEQKKFQQSKRAAVLIQQYY
RSYKEFGRLKPHHRGAAAALVQHKLRSSLLTKRQDQAARKIMRFLRRCRHRPSPLMDHRL
FKRGERIEKGQGT
Download sequence
Identical sequences I3KJL8
ENSONIP00000021313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]