SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021515 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021515
Domain Number 1 Region: 1757-1877
Classification Level Classification E-value
Superfamily Bromodomain 1.18e-34
Family Bromodomain 0.00021
Further Details:      
 
Domain Number 2 Region: 527-642
Classification Level Classification E-value
Superfamily DNA-binding domain 1.99e-22
Family Methyl-CpG-binding domain, MBD 0.011
Further Details:      
 
Domain Number 3 Region: 1641-1704
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.54e-16
Family PHD domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021515   Gene: ENSONIG00000017063   Transcript: ENSONIT00000021534
Sequence length 1882
Comment pep:known_by_projection scaffold:Orenil1.0:GL831137.1:5634288:5649572:1 gene:ENSONIG00000017063 transcript:ENSONIT00000021534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSNNHFNYGTHSSANSGLKLSSGDSLYTNGSSMSFPQQGKNMNGEMNVNGVTTVLGSSV
PGSHPPSAPYPHLSNHHQSSVGYDYLWGGHPQYGPASTPGMVQPQSQHHFQGHGQYQLNG
GIESSHQAPVAGPANMPLTGNQYWNRSNPGTQQMSYNSHGMYGTYQSQHYGMMPNGMPYY
QHQPQHPSLSSPQQQQQQPPPQQQTQPQAQAQMMPPAPQNFTPPRGSPQHHSLGRGSTGS
PLPVGMSSAQMMSPSAVQDSGSPKGHSRERSPHSSNVGMSSPMQGHARETVREVDTSYNG
SDRSPVAQRLPKTDSHQSKPPAAHVGPPSDYRQLSEQPAAQRPEMSSPVRDPAVNPPPQS
QLSVATANTSVSLTKSSAPPQVSAAPAFSGSPTSEAGPTIISSPDVESTSPQISTPPSVS
FAPSPTAAPRLSSPPLMVQGLRPPPPGTSDISPAGSKHLLVGSSSTSSLPVSPSKQSKPL
ASTDSLSRPAAVSSGPPVSSSLESAFHQKPATVSGPPFIGTGESGRRRVATEEQVQFPLL
HGWKREIRVKKMENRMKGETWYYTPCGRRMKQFPEIVKYLKKHTDSVVTREHFSFSPRMP
VGDFYEERETPEGVKWVLLANEEVPSMIMAITGRRGRPPNPDKEKPRRVRGLKGGQVRRP
GRPPKPKMIDFLSKVDAKLLKRLEAKEIEALTEEEKEKLAKIKKKMKRKVTLFICHPDFV
GAARMKRREDAKIKKMRDEKKRAKTDTDRVAQGKRVLGARSKAKALAKAQAEAEAAAQAV
LAAKRAAERRAQAQRRMEERKRQQLIAEELKKPTEDMCLTDHKPLPELSRIPGVVLSGTA
FAHCLAVVEFLHGYGKVIGLNIPKDIPSLATLQEGLLGLGDSQGELQDLLIKLVEAALHD
PGLPSYYQSVKILGEKLVELELTRSTVSEVLRIFLESHGYETEVCNTLRTKPFHALPPDT
KAAILGFLVEELNSSNTVINDIDNTVENMTTYRKNKWIIEGKLRKLKAVLSRRTGRSEEE
LCFEERRRSARVAEEENLSLEESGVVVLERGNRRARKEEPKSESPTNASIPELERQIDKL
TKRQAFFRKKLLQSSHSMRAILLGQDRYRRRYLALPHLGGVLVEGPEELLTSGEVLIAEV
PVTFLKKEPKKEPKVEEAPMPTTPPPTLPSSPTSATPGQAQTFSAEEEDPLPGTASLMSR
PRGRGRPRKIKPEVELHLRTAKIRRRRRSSVRSRSEEGPGSPNSGTQDLTQAAFQSWLSQ
SQEAVMNGTCSSAGEAPEGNRPEESVKEMAEKQGQWFNLLPKQPCDDNSLTPPALQDIPP
TGPDCAVPASSPPTNPQILPTPNPPAPSTPATPARPARRRRRGSRGSSPARRGPRGAAAK
RRGRPPNSVFQELEQQYFTQLVVKPIPASMVRGWWWIKTPEELYNTLQSLHPRGIREKVL
HKHLAKHMESLAEICTKPINDPMFELKVEEKDALLEALQQPWQVQEKTMETDISALQWVE
DLEQRVIAADLHLKPYTIPDPDSTRDDLQYYEHDADPRDDWIVRTKKEWSGLPRIATHPL
DLGVLRLANLERNIERRYLKEPLWNPAEVMRLAPLTPTPGEEHPMDVISLESEITSRLRT
WRQALDRCRSAPQLCLCLLQLEKAIAWERSVTKVTCQVCKKGDNDECLLLCDGCDRGCHM
YCLRPKITQIPEGDWFCPTCVAKDEDDSLCSSKKRTRVKKRRYEDDSSEDEVTTRRSGGM
TTRHKDVTPPSSSSRHSGEGSSAKRRRMTTRNQPDLTFCEIILMEMEAHADAWPFLEPVN
PRLVPGYRRIIKNPMDFLTMRERLLQGGYLSCEEFAADAQLVFNNCELFNEDTSEVGMAG
HSMRRFFESRWAEFYSRPKAEL
Download sequence
Identical sequences I3KK70
ENSONIP00000021515 ENSONIP00000021515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]