SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021530 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021530
Domain Number 1 Region: 458-708
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.96e-85
Family ABC transporter ATPase domain-like 0.00000103
Further Details:      
 
Domain Number 2 Region: 129-451
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 7.19e-76
Family ABC transporter transmembrane region 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021530   Gene: ENSONIG00000017076   Transcript: ENSONIT00000021549
Sequence length 720
Comment pep:known_by_projection scaffold:Orenil1.0:GL831287.1:453823:467793:-1 gene:ENSONIG00000017076 transcript:ENSONIT00000021549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLLIRVPGCTHKVHLSRLKLMQSRLLWLEHRPTFSAALRRTRQSTGLKSSLHPTPAFPV
WAARPYMTVLPRSPLMGIPVLCLQSRTLARTPVAFASSSAASTPAPAGSVKTQADTERSQ
TPTTVPLEDVKRILRLAHPERGRLAAAIGFLTVSSAVTMSAPFFLGRVIDTIYTSASDAE
TMTASLTSLCIMLAGVFLCGGACNAARVYLMQSSGQQIVRNLRASIFSSILRQEVAFFDK
NRTGELINRLSADTAVVGRSITDNLSDGLRAVAQAAAGVSMMFYVSPSLASFVLLIVPPM
AGLAVIYGRYLRSISKRTQDALAQATQLAEERISNMRTVRAFGKELSEVDKYTQKTDHVL
NLAKKEAVMRAGFFGVSGLSGNMMILSVLYHGGLLLSSQHMTVGELSSFLMYTFWVGISI
AGLSSFYSELMKGFGAGARLWELLDRKPEFPLNEGKILPADQLKGQLEFCDVSFAYPTRK
EAPIFQNLNLLVPAGSIMAVVGTSGSGKSSMVSLLLRLYDPDAGVITIDGHDVRDLNPYW
LRSQIGTVSQEPVLFSCSIRENIAYGATDPDAVTTEDIYRAAKVANAYDFIQMFPKGFDT
VVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEFLVQEALERLMEGRTV
VIIAHRLSTIKNADAVAVLDQRRIAECGQPTELLGNRQGLFRKLMEKQAFLQEEQQRALI
Download sequence
Identical sequences I3KK85
ENSONIP00000021530 ENSONIP00000021530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]