SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021540 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021540
Domain Number 1 Region: 717-1110
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.13e-92
Family Ankyrin repeat 0.00000352
Further Details:      
 
Domain Number 2 Region: 511-769
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.3e-61
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 3 Region: 24-79,146-291
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000162
Family Nucleotide and nucleoside kinases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021540   Gene: ENSONIG00000017083   Transcript: ENSONIT00000021559
Sequence length 1212
Comment pep:novel scaffold:Orenil1.0:GL831297.1:1219248:1227950:1 gene:ENSONIG00000017083 transcript:ENSONIT00000021559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEPQEQMSSSGFGSSSSLLRGRRFYCREWALDKLRRCLDAHSGPGQAPGVLVTGGPGAG
KTALCTEVVSPTSKAGLAVGLAQRCLAAHFCQREDQRSTVLWRFVLGLVEQLRASPLLSP
GYEELLNSPSVSSALEPLTCQRDPNETFKRAVLEPLSDLPPPAQTLMVVIDSLDIEYGPR
EGVRKSGSIAELLASSQHLLPSWLLLVCSVRRQNKALCKMFSSFRKLCLDDLRKPPAVRD
VQQYILCRLDKEAALRRQLTPDTADMLNLLHIKSGGCFLFLERVLDGVAASLVGLREIRD
IPGTLNGLYLWLCQRLFPRGRFIYIRPLLNALLAAPRPLTLQQLFTAVWTQDTLLSLQDF
ENKLQTLSALLIDGPGGTKLLFHASFTEWLTDVKYCTQKYLCSRTEGHSMLASSLTLQGP
NLDVEQTCQLATHLICSGHHKDKPAFLALWMLWAGVRALNPTCSKLPVSVSQEVAQLLMR
SGLVSPTFFSGADPSEEGIGVQQTLERETSIKNLLASGMSVNQPGSTDGQTLLASAAHEG
SANLAKLLLSHGSDPLISDHQGQTPLTLASRQGHVKVLSELLEWAKSQDPKTAVQMMEHV
DNEGWTALRSAAWGGHAEAVRLLLDAGADVDGCDSEGRTALRAAAWGGHDEIVLTLLDYG
AQVDKADSKDRTPLIAAAYMGHHEAVAILLDHNARVDLADGDGRTALSVAALCVPTAAGV
KGFGEVASLLLERGADPGHRDHDGMTPLLLASYEGHEDVVELLLEAGADVDETAGPDGSV
PAAAAVTPLLAAAAMGHMKTVSRLLFWGAAVDAIDCEGRTALCLAAARGSVEVVRTLLDR
GLDENHKDDLGWTPLHAAACEGHRAVCAVLTEEGSMARVGEMDIEGRTPLILAAQEGHWS
TAKLLLDRRSPIDHRAYDGHSALSAALLEGHADVAELLMKRGADTDVRDAEGRPLLYLLV
LEGRLDMATLLIEKGGVPLESRDSEGRTALHVASWQGCVEIVDLLLRHGANPNAQDAEGR
PPIHSVAWTGHAKVGHRLLEASGININLACHQGATALSIAAQEGHANIVAMLLERGSNPN
HMDKYGRSPVKVAGKHGHYNIVRMLESYGAKPYLGVLPNSSTVSPSKSNMIPSLGISESS
GGEVTVATSSSSVSSPGSTAERFHSMQSSQTSSTCHSLATVQTVPADSLSFIQQIQQHSL
PRSRSRNSTLPP
Download sequence
Identical sequences I3KK95
ENSONIP00000021540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]