SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021545 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021545
Domain Number 1 Region: 156-266
Classification Level Classification E-value
Superfamily Bromodomain 2.88e-28
Family Bromodomain 0.00038
Further Details:      
 
Domain Number 2 Region: 273-403
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.89e-21
Family PWWP domain 0.009
Further Details:      
 
Domain Number 3 Region: 84-138
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000494
Family PHD domain 0.01
Further Details:      
 
Domain Number 4 Region: 1023-1065
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000436
Family MYND zinc finger 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000021545
Domain Number - Region: 926-1023
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00196
Family Apolipoprotein A-I 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021545   Gene: ENSONIG00000017087   Transcript: ENSONIT00000021564
Sequence length 1125
Comment pep:known_by_projection scaffold:Orenil1.0:GL831137.1:5784417:5798520:1 gene:ENSONIG00000017087 transcript:ENSONIT00000021564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASVRSKVPDPPGSAERSVAPQKRKVSSPTHSSNGHSPSDTSPSPLKKKKKPGAMNCNN
KDQSELRHGPFYYMKQPALTTDPVDVVPQDGRNDFYCWLCHREGQVLCCELCPRVYHAKC
LKLPAEPEGDWFCPECEKITVAECIETQSKAMTMLTIDQLSYLLKFALQKIKQPGTEPFQ
KPVSLEQHPDYAEYIFHPMDLCTLEKNVKKKMYGCTEAFLADVKWILHNCIIYNGGNHKL
TATAKVIVRICEHEMNEIEVCPECYLSACQKRDNWFCEPCSQPHPLVWAKLKGFPFWPAK
ALREKDGQVDARFFGQHDRAWVPINNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENIR
KKFGVFNYAPFRTPYTPNNQLQMLVDPSNPGAGTVKTEKPDKLRFNFDITASPKMVLGKS
STPSSMNRRVSMTDMPRSPMSTNSSVHTGSDGEQDVEKGNRNPALHYSTGEESMDCTASP
VSGKMGPGGSVSGSPKPFNPGLVPKQERTAGTGGILNLNLDRVKAEMDLKELSETVQQQQ
QQQGVPAPPSTPKRPIRSLDKTIESCKAQLGIDEISEDAYKDVDHSDSEDSEKSDSSDSE
YLSDEEHKPKSSAQEDKDKMERKRSKASTDGENKEGALATGDKATPEPPLKEKQGSNGPD
RDLKDKPRTPQSQPLADKPKAPEDVKAAAATSAAEQDSDSERELVIDLGDEHGGRDSKRA
KRELGSSTAKTPKESNVAKLEGKLPSSAASVAPARDVTSSTKDSSQPSVTSALNLVSSAA
SAQPSATTTTSGSTSAPSPVSTSSPVTTAVKKQRPLLPKETAQAVQRAVVWNPTKFQTSS
QKWHMQKMQRQQQQDGEQSAVQTRSPQQQNSSSSTRYQTRQAAKGQQKDPPLSASSSTSA
QVTSGSSSFMSGDLQIPTVSADVAADIAKYTNKIMDTIKGTMTEIYNDLSKSTSGNTIAE
IRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERERLVAEVKKQTELEKQQAV
DETKKKQWCANCRKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATASQQEPEADPNP
EPSVKSSGHSPATQTVPSGSGSISDKSNSPTYMDKSKDSAGVTVT
Download sequence
Identical sequences I3KKA0
ENSONIP00000021545 XP_013130445.1.78416 XP_013130455.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]