SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021546 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021546
Domain Number 1 Region: 172-282
Classification Level Classification E-value
Superfamily Bromodomain 2.88e-28
Family Bromodomain 0.00038
Further Details:      
 
Domain Number 2 Region: 289-419
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.89e-21
Family PWWP domain 0.009
Further Details:      
 
Domain Number 3 Region: 100-154
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000494
Family PHD domain 0.01
Further Details:      
 
Domain Number 4 Region: 1031-1073
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000436
Family MYND zinc finger 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000021546
Domain Number - Region: 934-1031
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00196
Family Apolipoprotein A-I 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021546   Gene: ENSONIG00000017087   Transcript: ENSONIT00000021565
Sequence length 1127
Comment pep:known_by_projection scaffold:Orenil1.0:GL831137.1:5787772:5797430:1 gene:ENSONIG00000017087 transcript:ENSONIT00000021565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLAEEEIKTESDVVEGMDASVRSKVPDPPGSAERSVAPQKRKVSSPTHSSNGHSPSDTSP
SPLKKKKKPGAMNCNNKDQSELRHGPFYYMKQPALTTDPVDVVPQDGRNDFYCWLCHREG
QVLCCELCPRVYHAKCLKLPAEPEGDWFCPECEKITVAECIETQSKAMTMLTIDQLSYLL
KFALQKIKQPGTEPFQKPVSLEQHPDYAEYIFHPMDLCTLEKNVKKKMYGCTEAFLADVK
WILHNCIIYNGGNHKLTATAKVIVRICEHEMNEIEVCPECYLSACQKRDNWFCEPCSQPH
PLVWAKLKGFPFWPAKALREKDGQVDARFFGQHDRAWVPINNCYLMSKEIPFSVKKTKSI
FNSAMQEMEVYVENIRKKFGVFNYAPFRTPYTPNNQLQMLVDPSNPGAGTVKTEKPDKLR
FNFDITASPKMVLGKSSTPSSMNRRVSMTDMPRSPMSTNSSVHTGSDGEQDVEKGNRNPA
LHYSTGEESMDCTEKKKNLFITASPVSGKMGPGGSVSGSPKPFNPGLVPKQERTAGTGGI
LNLNLDRVKAEMDLKELSETVQQQQQQQGVPAPPSTPKRPIRSLDKTIESCKAQLGIDEI
SEDAYKDVDHSDSEDSEKSDSSDSEYLSDEEHKPKSSAQEDKDKMERKRSKASTDGENKE
GALATGDKATPEPPLKEKQGSNGPDRDLKDKPRTPQSQPLADKPKAPEDVKAAAATSAAE
QDSDSERELVIDLGDEHGGRDSKRAKREKRKLPSSAASVAPARDVTSSTKDSSQPSVTSA
LNLVSSAASAQPSATTTTSGSTSAPSPVSTSSPVTTAVKKQRPLLPKETAQAVQRAVVWN
PTKFQTSSQKWHMQKMQRQQQQDGEQSAVQTRSPQQQNSSSSTRYQTRQAAKGQQKDPPL
SASSSTSAQVTSGSSSFMSGDLQIPTVSADVAADIAKYTNKIMDTIKGTMTEIYNDLSKS
TSGNTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERERLVAEVKKQT
ELEKQQAVDETKKKQWCANCRKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATASQQ
EPEADPNPEPSVKSSGHSPATQTVPSGSGSISDKSNSPTYMDKSKDS
Download sequence
Identical sequences I3KKA1
ENSONIP00000021546 ENSONIP00000021546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]