SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021703 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021703
Domain Number 1 Region: 639-740
Classification Level Classification E-value
Superfamily Bromodomain 3.79e-28
Family Bromodomain 0.00048
Further Details:      
 
Domain Number 2 Region: 262-336
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.86e-18
Family PHD domain 0.0095
Further Details:      
 
Domain Number 3 Region: 1134-1248
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.95e-18
Family PWWP domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000021703
Domain Number - Region: 374-414
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000161
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021703   Gene: ENSONIG00000017204   Transcript: ENSONIT00000021722
Sequence length 1264
Comment pep:known_by_projection scaffold:Orenil1.0:GL831137.1:7090434:7099321:1 gene:ENSONIG00000017204 transcript:ENSONIT00000021722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPTPAQAVPQKK
RKGRPPRASLTGSGPNRSERSHSPGRETMTYAQAQRMVEVEIQGRIHRISIFENIDVVSD
EDSDAEDAPSSGTDIPSSNGGKSTPKTGKHKSKAKKKDGLSHHHSAQSGPAVKLPEAVFR
ELDQDRPDAPPRPLSYYRYIDKSVEELDEEVEYDIDEEDYIWLDIMNDKRRRDGVTPIPQ
EVFEYLMDRLEKESYFESHNKADPSTLIDEDAVCCICNDGECQNSNVILFCDMCNLAVHQ
ECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDARWAHVVCALWIPEVCF
ANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYMK
MEPVRETGANGTSFSVRKTAYCDIHTPPGSARPLGGVGGASMGSSNSEGELEEDDEPSIG
HDDDSKGWSSERVKRAKAKSRLKMKRARKILAERRAAAPVVSVPCIPPHRLSKITSNLTV
PRKSQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRHIDPLPRDSEEKQTALKEQLKA
WQRLRHDLERARLLVELIRKREKLKRETIKVQQMALEMQLTPFLVLLRSTLEQLQERDTN
NFFTEPVPLAEVPDYLDHIDTPMDFQTMWNLLESHRYLTFEAFEADFGLIVNNCLKYNAK
DTVFYRAALRLREMGGAVIRTARRQAERIGFDYETGMHLPREPSPESQREQERDRERENL
LLPENRRRLPLEEQLHYLQARLDEVSSGKHSIGQSRRAKALRKEISVIKRKLAHQREGGS
GMGGRDSVGGGDRSSSLPHHSSSAGHHDEGGESSSQEIGGKGVSRNVSSSLTPEVGRRTS
VLFSKKNQKIAGPPKRPGRPPKNRDAGYGGAGVSQSPVGPPQLPLLSPSRHRKRPRSPHT
SSSSDSDSDNDDLLPDFLPSGLPTNGFDTGNQPVTESFRVYRSEPHLPRSSSDSESTTSS
SSSAASDRTSTTPSKQGRGKASFSRAFQEDSSEETSGTENDSYSVGGSRGVSHCNNLSQP
PHVSIAGPVLAVLIMGKMKHGLRKCPPLEKQISVVRGRDRSGCWMASDDYSSLEALDLVW
AKCRGYPSYPALIIDPKMPREGVFHRGVPIPVPPLDVLKLGEQMTQEAREHLFLVLFFDN
KRTWQWLPRSKLVPLGVDQELDKEKMLEGRKSNIRKSVQVAYHRAMQHRSKVQGDPSSET
SDSD
Download sequence
Identical sequences I3KKQ8
ENSONIP00000021703 ENSONIP00000021703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]