SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021729 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021729
Domain Number 1 Region: 48-304
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.18e-50
Family ABC transporter ATPase domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021729   Gene: ENSONIG00000017227   Transcript: ENSONIT00000021748
Sequence length 530
Comment pep:known_by_projection scaffold:Orenil1.0:GL831398.1:124981:142891:1 gene:ENSONIG00000017227 transcript:ENSONIT00000021748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDPRTVCVCMDEVVNKRPAGSQQTPLLQGHLKKLDNNLTEAQRFSSLPRRPAVNIEFKD
VSFVVTEGPWWRKKGYKTLLKAISGKFTSGDLVAIMGPSGAGKSTLMNILAGYRETGMKG
EILINGQPRDLRSFRKVSCYIMQDDMLLPHLSVHEAMMVSASLKLQEKEEARRDMVQDIL
MALGLLECAQTRTSHLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSSSCFQVVSLLKA
LARGGRTVICTIHQPSAKLFELFDKLYVLSQGQCIYRGQVSSLVPYLRDLGLNCPTYHNP
ADFVMEVASGEYGDQMIRLVTAAQERKSQKDHQPELNGDSTLHPFLWQRTEEESSSSEGC
HSFSASCMTQFSILFRRTFLSILRDSVVFPVVYCSIVYWMTAQPPDAGRFFLFLSLGILT
SLVAQSLGLLIGAASTSLQVRSLFPSSPPVRSQVCSGADITQVCLFPTGGHVCGPGHGDP
GSAVLRVLRQLRYHPLVPAVDVLHLLRQVGELLAGTGLRASSCQSTAWAV
Download sequence
Identical sequences I3KKT4
ENSONIP00000021729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]