SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021748 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021748
Domain Number 1 Region: 20-311
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.9e-88
Family PAPS sulfotransferase 0.0000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021748   Gene: ENSONIG00000017244   Transcript: ENSONIT00000021767
Sequence length 312
Comment pep:novel scaffold:Orenil1.0:GL831137.1:7391780:7395145:1 gene:ENSONIG00000017244 transcript:ENSONIT00000021767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAEGPLSLCMSLDPEKAVLPSRQQLFDFHGVSMIPIFTDNWENVQNFQARPDDILIATYP
KAGTTWVSQILDLLYFGQTERQKTIPIFERVPFLEIAVPSLVSGKDLADKLTTTPRLIKT
HFPVQFVPKSFWEQNCKIVYVARNAKDNMVSFFHFDRMNMAHPDPGDWSNYIHRFMEGKI
SVALVVFGSWYDHVNGWWKKKQTYSNIHYMFYEDMIEDTEREIDKLCSFLSLSRSADEKK
MIAGGVQFDNMKKNEMTNYSTFSILDFKISPFMRKGKVGDWKNHFTVAQNEVFDEDYKKK
MKDPTLQFRTEI
Download sequence
Identical sequences I3KKV3
ENSONIP00000021748 ENSONIP00000021748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]